Knowledge Summary

Patent

No data available

Synonym

Accession Q499Y3
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MRAVSANYSTGSPAVKSRIELDRIQTIMESMGSKLSPGAQQLINMVRFQQWNCIPIEEQLQLVLGNAGYK      1 - 70
QMTGLQCSSALGALDKLSSTPFPFRTGLTSGNVTENLQAYIDKSTQASSGENSTKLDECKIVPQNHSLLE     71 - 140
NDLKNATSPFLPKKANDNSNIPNSELLPFLQNLCSQVNYLLVGRKAE                           141 - 187
//

Text Mined References (1)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).