Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.07
PubTator Score 1.00

Knowledge Summary

Patent (141)

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 6.7e-09

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.500 6.7e-09

Gene RIF (2)

AA Sequence

MYTVLTGTPPFMASPLSEMYQNIREGHYPEPAHLSANARRLIVHLLAPNPAERPSLDHLLQDDFFTQGFT      1 - 70
PDRLPAHSCHSPPIFAIPPPLGRIFRKVGQRLLTQCRPPCPFTPKEASGPGEGGPDPDSMEWDGESSLSA     71 - 140
KEVPCLEGPIHLVAQGTLQSDLAGPEGSRRPEVEAALRHLQLCLDVGPPATQDPLGEQQPILWAPKWVDY    141 - 210
SSKYGFGYQLLDGGRTGRHPHGPATPRREGTLPTPVPPAGPGLCLLRFLASEHALLLLFSNGMVQVSFSG    211 - 280
VPAQLVLSGEGEGLQLTLWEQGSPGTSYSLDVPRSHGCAPTTGQHLHHALRMLQSI                  281 - 336
//

Text Mined References (10)

PMID Year Title