Property Summary

NCBI Gene PubMed Count 16
Grant Count 10
R01 Count 5
Funding $841,844.75
PubMed Score 16.32
PubTator Score 14.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytoma -2.300 0.000
glioblastoma multiforme -2.500 0.000
oligodendroglioma -2.200 0.000
posterior fossa group A ependymoma -3.300 0.000
medulloblastoma, large-cell -1.800 0.007
adult high grade glioma -2.700 0.000
pilocytic astrocytoma -1.500 0.006
sonic hedgehog group medulloblastoma -2.800 0.000
ovarian cancer -1.900 0.000

 GO Process (1)

Gene RIF (7)

PMID Text
25282537 Studies indicate that botulinum neurotoxins (BoNTs) in complex with its protein receptor, synaptic vesicle glycoprotein 2 (SV2) family member C represented a major advance for the detailed molecular understanding of BoNT-host cell receptor interactions.
25117820 A genetic variant in SV2C predicted clinically relevant bevacizumab-induced hypertension in two independent, randomised phase III trials.
24240280 high-resolution crystal structure of the BoNT/A receptor-binding domain in complex with the SV2C luminal domain
23886675 The fact that multiple SNPs in SV2C may impact response to atypical antipsychotics suggests that further evaluation of SNPs in this gene
23617838 In classical mesial temporal sclerosis 1A, the expression of SV2 isoforms is altered with a selective increase of SV2C in sprouting mossy fibres.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18977120 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)

AA Sequence

MEDSYKDRTSLMKGAKDIAREVKKQTVKKVNQAVDRAQDEYTQRSYSRFQDEEDDDDYYPAGETYNGEAN      1 - 70
DDEGSSEATEGHDEDDEIYEGEYQGIPSMNQAKDSIVSVGQPKGDEYKDRRELESERRADEEELAQQYEL     71 - 140
IIQECGHGRFQWALFFVLGMALMADGVEVFVVGFVLPSAETDLCIPNSGSGWLGSIVYLGMMVGAFFWGG    141 - 210
LADKVGRKQSLLICMSVNGFFAFLSSFVQGYGFFLFCRLLSGFGIGGAIPTVFSYFAEVLAREKRGEHLS    211 - 280
WLCMFWMIGGIYASAMAWAIIPHYGWSFSMGSAYQFHSWRVFVIVCALPCVSSVVALTFMPESPRFLLEV    281 - 350
GKHDEAWMILKLIHDTNMRARGQPEKVFTVNKIKTPKQIDELIEIESDTGTWYRRCFVRIRTELYGIWLT    351 - 420
FMRCFNYPVRDNTIKLTIVWFTLSFGYYGLSVWFPDVIKPLQSDEYALLTRNVERDKYANFTINFTMENQ    421 - 490
IHTGMEYDNGRFIGVKFKSVTFKDSVFKSCTFEDVTSVNTYFKNCTFIDTVFDNTDFEPYKFIDSEFKNC    491 - 560
SFFHNKTGCQITFDDDYSAYWIYFVNFLGTLAVLPGNIVSALLMDRIGRLTMLGGSMVLSGISCFFLWFG    561 - 630
TSESMMIGMLCLYNGLTISAWNSLDVVTVELYPTDRRATGFGFLNALCKAAAVLGNLIFGSLVSITKSIP    631 - 700
ILLASTVLVCGGLVGLCLPDTRTQVLM                                               701 - 727
//

Publication (16)

PMID Year Title
25282537 2014 Botulinum neurotoxins: new questions arising from structural biology.
25117820 2014 Genetic variant predicts bevacizumab-induced hypertension in ECOG-5103 and ECOG-2100.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24240280 2014 Structural basis for recognition of synaptic vesicle protein 2C by botulinum neurotoxin A.
23886675 2013 Genotypic variation in the SV2C gene impacts response to atypical antipsychotics the CATIE study.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23650146 2013 A genome-wide association study for venous thromboembolism: the extended cohorts for heart and aging research in genomic epidemiology (CHARGE) consortium.
23617838 2014 Expression pattern of synaptic vesicle protein 2 (SV2) isoforms in patients with temporal lobe epilepsy and hippocampal sclerosis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18977120 2009 No major role of common SV2A variation for predisposition or levetiracetam response in epilepsy.
More...