Property Summary

NCBI Gene PubMed Count 17
PubMed Score 20.97
PubTator Score 14.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -2.700 5.6e-05
astrocytoma -2.300 1.9e-18
Astrocytoma, Pilocytic -1.500 6.4e-03
ependymoma -2.600 4.7e-06
glioblastoma -2.500 1.6e-07
medulloblastoma, large-cell -1.800 7.1e-03
oligodendroglioma -2.200 1.3e-10
ovarian cancer 1.100 1.7e-09
sonic hedgehog group medulloblastoma -2.800 4.9e-06

Protein-protein Interaction (6)

Gene RIF (8)

AA Sequence

MEDSYKDRTSLMKGAKDIAREVKKQTVKKVNQAVDRAQDEYTQRSYSRFQDEEDDDDYYPAGETYNGEAN      1 - 70
DDEGSSEATEGHDEDDEIYEGEYQGIPSMNQAKDSIVSVGQPKGDEYKDRRELESERRADEEELAQQYEL     71 - 140
IIQECGHGRFQWALFFVLGMALMADGVEVFVVGFVLPSAETDLCIPNSGSGWLGSIVYLGMMVGAFFWGG    141 - 210
LADKVGRKQSLLICMSVNGFFAFLSSFVQGYGFFLFCRLLSGFGIGGAIPTVFSYFAEVLAREKRGEHLS    211 - 280
WLCMFWMIGGIYASAMAWAIIPHYGWSFSMGSAYQFHSWRVFVIVCALPCVSSVVALTFMPESPRFLLEV    281 - 350
GKHDEAWMILKLIHDTNMRARGQPEKVFTVNKIKTPKQIDELIEIESDTGTWYRRCFVRIRTELYGIWLT    351 - 420
FMRCFNYPVRDNTIKLTIVWFTLSFGYYGLSVWFPDVIKPLQSDEYALLTRNVERDKYANFTINFTMENQ    421 - 490
IHTGMEYDNGRFIGVKFKSVTFKDSVFKSCTFEDVTSVNTYFKNCTFIDTVFDNTDFEPYKFIDSEFKNC    491 - 560
SFFHNKTGCQITFDDDYSAYWIYFVNFLGTLAVLPGNIVSALLMDRIGRLTMLGGSMVLSGISCFFLWFG    561 - 630
TSESMMIGMLCLYNGLTISAWNSLDVVTVELYPTDRRATGFGFLNALCKAAAVLGNLIFGSLVSITKSIP    631 - 700
ILLASTVLVCGGLVGLCLPDTRTQVLM                                               701 - 727
//

Text Mined References (17)

PMID Year Title