Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.20
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
18265009 CPG15 and CPG15-2 perform similar cellular functions but may play distinct roles in vivo through their cell-type- and tissue-specific transcriptional regulation.

AA Sequence

MMRCCRRRCCCRQPPHALRPLLLLPLVLLPPLAAAAAGPNRCDTIYQGFAECLIRLGDSMGRGGELETIC      1 - 70
RSWNDFHACASQVLSGCPEEAAAVWESLQQEARQAPRPNNLHTLCGAPVHVRERGTGSETNQETLRATAP     71 - 140
ALPMAPAPPLLAAALALAYLLRPLA                                                 141 - 165
//

Publication (5)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
18265009 2008 cpg15 and cpg15-2 constitute a family of activity-regulated ligands expressed differentially in the nervous system to promote neurite growth and neuronal survival.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.