Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.20
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Synonym

Accession Q496H8 Q6UWH7
Symbols UNQ2446

Gene

  Ortholog (3)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Anole lizard EggNOG Inparanoid

Gene RIF (1)

PMID Text
18265009 CPG15 and CPG15-2 perform similar cellular functions but may play distinct roles in vivo through their cell-type- and tissue-specific transcriptional regulation.

AA Sequence

MMRCCRRRCCCRQPPHALRPLLLLPLVLLPPLAAAAAGPNRCDTIYQGFAECLIRLGDSMGRGGELETIC      1 - 70
RSWNDFHACASQVLSGCPEEAAAVWESLQQEARQAPRPNNLHTLCGAPVHVRERGTGSETNQETLRATAP     71 - 140
ALPMAPAPPLLAAALALAYLLRPLA                                                 141 - 165
//

Text Mined References (5)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
18265009 2008 cpg15 and cpg15-2 constitute a family of activity-regulated ligands expressed differentially in the nervous system to promote neurite growth and neuronal survival.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.