Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.20
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q496H8 Q6UWH7
Symbols UNQ2446
cpg15-2
MRCC2446

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (1)

Gene RIF (1)

AA Sequence

MMRCCRRRCCCRQPPHALRPLLLLPLVLLPPLAAAAAGPNRCDTIYQGFAECLIRLGDSMGRGGELETIC      1 - 70
RSWNDFHACASQVLSGCPEEAAAVWESLQQEARQAPRPNNLHTLCGAPVHVRERGTGSETNQETLRATAP     71 - 140
ALPMAPAPPLLAAALALAYLLRPLA                                                 141 - 165
//

Text Mined References (6)

PMID Year Title