Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
diabetes mellitus 1,663

Expression

AA Sequence

MEWWDKSEESLEEEPRKVLAPEPEEIWVAEMLCGLKMKLKRRRVSLVLPEHHEAFNRLLEDPVIKRFLAW      1 - 70
DKGLRVSDKYLLAMVIVYFSRAGLPSWQYQCIHFFLALYLANDMEEDDEDPKQNIFYFLYGKTRSRIPLL     71 - 140
RKRRFQLCRCMNPRARKNRSQIVLFQKLRFQFFCSMSCRAWVSPEELEEIQAYDPEHWVWARDRARLS      141 - 208
//

Text Mined References (3)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.