Property Summary

NCBI Gene PubMed Count 5
Grant Count 8
R01 Count 8
Funding $1,340,150.83
PubMed Score 22.37
PubTator Score 3.95

Knowledge Summary

Patent

No data available

Gene RIF (2)

PMID Text
19910524 lysophosphatidic acid stimulates apical Cl(-)/OH(-) exchange activity and surface levels of SLC36A3 and SLC26A6 in intestinal epithelial cells
12809675 PAT3 was isolated and identified, but its function is not yet known.

AA Sequence

MSLLGRDYNSELNSLDNGPQSPSESSSSITSENVHPAGEAGLSMMQTLIHLLKCNIGTGLLGLPLAIKNA      1 - 70
GLLVGPVSLLAIGVLTVHCMVILLNCAQHLSQRLQKTFVNYGEATMYGLETCPNTWLRAHAVWGRYTVSF     71 - 140
LLVITQLGFCSVYFMFMADNLQQMVEKAHVTSNICQPREILTLTPILDIRFYMLIILPFLILLVFIQNLK    141 - 210
VLSVFSTLANITTLGSMALIFEYIMEGIPYPSNLPLMANWKTFLLFFGTAIFTFEGVGMVLPLKNQMKHP    211 - 280
QQFSFVLYLGMSIVIILYILLGTLGYMKFGSDTQASITLNLPNCWLYQSVKLMYSIGIFFTYALQFHVPA    281 - 350
EIIIPFAISQVSESWALFVDLSVRSALVCLTCVSAILIPRLDLVISLVGSVSSSALALIIPALLEIVIFY    351 - 420
SEDMSCVTIAKDIMISIVGLLGCIFGTYQALYELPQPISHSMANSTGVHA                        421 - 470
//

Publication (7)

PMID Year Title
23506890 Evolutionary origin of amino acid transporter families SLC32, SLC36 and SLC38 and physiological, pathological and therapeutic aspects.
19910524 2010 Mechanisms of lysophosphatidic acid (LPA) mediated stimulation of intestinal apical Cl-/OH- exchange.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15058382 2004 Organization and expression of the SLC36 cluster of amino acid transporter genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12809675 2003 A cluster of proton/amino acid transporter genes in the human and mouse genomes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.