Property Summary

NCBI Gene PubMed Count 27
PubMed Score 40.16
PubTator Score 571.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
USHER SYNDROME, TYPE IG 1 0.0 0.0
Disease Target Count
Usher Syndrome, Type I 6
Disease Target Count P-value
osteosarcoma 7950 1.8e-05
medulloblastoma, large-cell 6241 1.7e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Usher syndrome 32 6.266 3.1
Disease Target Count Z-score Confidence
Retinitis Pigmentosa 226 4.51 2.3

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.300 1.7e-04
osteosarcoma 1.269 1.8e-05

Gene RIF (15)

AA Sequence

MNDQYHRAARDGYLELLKEATRKELNAPDEDGMTPTLWAAYHGNLESLRLIVSRGGDPDKCDIWGNTPLH      1 - 70
LAASNGHLHCLSFLVSFGANIWCLDNDYHTPLDMAAMKGHMECVRYLDSIAAKQSSLNPKLVGKLKDKAF     71 - 140
REAERRIRECAKLQRRHHERMERRYRRELAERSDTLSFSSLTSSTLSRRLQHLALGSHLPYSQATLHGTA    141 - 210
RGKTKMQKKLERRKQGGEGTFKVSEDGRKSARSLSGLQLGSDVMFVRQGTYANPKEWGRAPLRDMFLSDE    211 - 280
DSVSRATLAAEPAHSEVSTDSGHDSLFTRPGLGTMVFRRNYLSSGLHGLGREDGGLDGVGAPRGRLQSSP    281 - 350
SLDDDSLGSANSLQDRSCGEELPWDELDLGLDEDLEPETSPLETFLASLHMEDFAALLRQEKIDLEALML    351 - 420
CSDLDLRSISVPLGPRKKILGAVRRRRQAMERPPALEDTEL                                 421 - 461
//

Text Mined References (27)

PMID Year Title