Property Summary

NCBI Gene PubMed Count 8
Grant Count 7
R01 Count 6
Funding $480,625.95
PubMed Score 8.16
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
18239089 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18239089 genome search identified sequence variants in the 4p16.3 region correlated with recombination rate in males & females; variants are located in the RNF212 gene, a putative ortholog of ZHP-3 gene essential for recombination & chiasma formation in C elegans
15340062 This paper describes a partial transcript of the human RNF212 gene.

AA Sequence

MANWVFCNRCFQPPHRTSCFSLTNCGHVYCDACLGKGKKNECLICKAPCRTVLLSKHTDADIQAFFMSID      1 - 70
SLCKKYSRETSQILEFQEKHRKRLLAFYREKISRLEESLRKSVLQIEQLQSMRSSQQTAFSTIKSSVSTK     71 - 140
PHGCLLPPHSSAPDRLESMEVDLSPSPIRKSEIAAGPARISMISPPQDGRMGPHLTASFCFIPWLTLSKP    141 - 210
PVPGECVISRGSPCFCIDVCPHWLLLLAFSSGRHGELTNSKTLPIYAEVQRAVLFPFQQAEGTLDTFRTP    211 - 280
AVSVVFPLCQFERKKSF                                                         281 - 297
//

Publication (9)

PMID Year Title
23396135 2013 RNF212 is a dosage-sensitive regulator of crossing-over during mammalian meiosis.
19763160 2009 Genetic analysis of variation in human meiotic recombination.
18239089 2008 Sequence variants in the RNF212 gene associate with genome-wide recombination rate.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340062 2004 Targeted gene knockout reveals a role in meiotic recombination for ZHP-3, a Zip3-related protein in Caenorhabditis elegans.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.