Property Summary

NCBI Gene PubMed Count 8
PubMed Score 8.16
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00709681897744888
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0116276747770037
Disease Target Count Z-score Confidence
Male infertility 170 3.802 1.9

Expression

Synonym

Accession Q495C1 C9J8N0 Q495C0 Q86W82 Q8IY99 Q8N8U7
Symbols ZHP3

Gene

  Ortholog (5)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid

Gene RIF (3)

PMID Text
18239089 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18239089 genome search identified sequence variants in the 4p16.3 region correlated with recombination rate in males & females; variants are located in the RNF212 gene, a putative ortholog of ZHP-3 gene essential for recombination & chiasma formation in C elegans
15340062 This paper describes a partial transcript of the human RNF212 gene.

AA Sequence

MANWVFCNRCFQPPHRTSCFSLTNCGHVYCDACLGKGKKNECLICKAPCRTVLLSKHTDADIQAFFMSID      1 - 70
SLCKKYSRETSQILEFQEKHRKRLLAFYREKISRLEESLRKSVLQIEQLQSMRSSQQTAFSTIKSSVSTK     71 - 140
PHGCLLPPHSSAPDRLESMEVDLSPSPIRKSEIAAGPARISMISPPQDGRMGPHLTASFCFIPWLTLSKP    141 - 210
PVPGECVISRGSPCFCIDVCPHWLLLLAFSSGRHGELTNSKTLPIYAEVQRAVLFPFQQAEGTLDTFRTP    211 - 280
AVSVVFPLCQFERKKSF                                                         281 - 297
//

Text Mined References (9)

PMID Year Title
23396135 2013 RNF212 is a dosage-sensitive regulator of crossing-over during mammalian meiosis.
19763160 2009 Genetic analysis of variation in human meiotic recombination.
18239089 2008 Sequence variants in the RNF212 gene associate with genome-wide recombination rate.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340062 2004 Targeted gene knockout reveals a role in meiotic recombination for ZHP-3, a Zip3-related protein in Caenorhabditis elegans.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.