Property Summary

NCBI Gene PubMed Count 8
PubMed Score 8.45
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Male infertility 206 4.14 2.1

Expression

  Differential Expression (2)

Gene RIF (3)

AA Sequence

MANWVFCNRCFQPPHRTSCFSLTNCGHVYCDACLGKGKKNECLICKAPCRTVLLSKHTDADIQAFFMSID      1 - 70
SLCKKYSRETSQILEFQEKHRKRLLAFYREKISRLEESLRKSVLQIEQLQSMRSSQQTAFSTIKSSVSTK     71 - 140
PHGCLLPPHSSAPDRLESMEVDLSPSPIRKSEIAAGPARISMISPPQDGRMGPHLTASFCFIPWLTLSKP    141 - 210
PVPGECVISRGSPCFCIDVCPHWLLLLAFSSGRHGELTNSKTLPIYAEVQRAVLFPFQQAEGTLDTFRTP    211 - 280
AVSVVFPLCQFERKKSF                                                         281 - 297
//

Text Mined References (9)

PMID Year Title