Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.05
PubTator Score 0.14

Knowledge Summary

Patent

No data available

Expression

 GO Process (1)

 Compartment GO Term (2)

AA Sequence

MQEELAWETDGLLPLERQLHEAARQNNVGRMQELIGRRVNTRARNHVGRVALHWAAGAGHEQAVRLLLEH      1 - 70
EAAVDEEDAVGALTEARLCFGMNALLLSAWFGHLRILQILVNSGAKIHCESKDGLTLLHCAAQKGHVPVL     71 - 140
AFIMEDLEDVALDHVDKLGRTAFHRAAEHGQLDALDFLVGSGCDHNVKDKEGNTALHLAAGRGHMAVLQR    141 - 210
LVDIGLDLEEQNAEGLTALHSAAGGSHPDCVQLLLRAGSTVNALTQKNLSCLHYAALSGSEDVSRVLIHA    211 - 280
GGCANVVDHQGASPLHLAVRHNFPALVRLLINSDSDVNAVDNRQQTPLHLAAEHAWQDIADMLLIAGVDL    281 - 350
NLRDKQGKTALAVAVRSNHVSLVDMIIKADRFYRWEKDHPSDPSGKSLSFKQDHRQETQQLRSVLWRLAS    351 - 420
RYLQPREWKKLAYSWEFTEAHVDAIEQQWTGTRSYQEHGHRMLLIWLHGVATAGENPSKALFEGLVAIGR    421 - 490
RDLAGWSTMARSQLTATSASRVQMILVPQPPE                                          491 - 522
//

Text Mined References (5)

PMID Year Title