Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.05
PubTator Score 0.14

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q495B1 Q495B2 Q495B3 Q8N7A0 Q8NBS5
Symbols

Gene

 GO Process (1)

 Compartment GO Term (1)

AA Sequence

MQEELAWETDGLLPLERQLHEAARQNNVGRMQELIGRRVNTRARNHVGRVALHWAAGAGHEQAVRLLLEH      1 - 70
EAAVDEEDAVGALTEARLCFGMNALLLSAWFGHLRILQILVNSGAKIHCESKDGLTLLHCAAQKGHVPVL     71 - 140
AFIMEDLEDVALDHVDKLGRTAFHRAAEHGQLDALDFLVGSGCDHNVKDKEGNTALHLAAGRGHMAVLQR    141 - 210
LVDIGLDLEEQNAEGLTALHSAAGGSHPDCVQLLLRAGSTVNALTQKNLSCLHYAALSGSEDVSRVLIHA    211 - 280
GGCANVVDHQGASPLHLAVRHNFPALVRLLINSDSDVNAVDNRQQTPLHLAAEHAWQDIADMLLIAGVDL    281 - 350
NLRDKQGKTALAVAVRSNHVSLVDMIIKADRFYRWEKDHPSDPSGKSLSFKQDHRQETQQLRSVLWRLAS    351 - 420
RYLQPREWKKLAYSWEFTEAHVDAIEQQWTGTRSYQEHGHRMLLIWLHGVATAGENPSKALFEGLVAIGR    421 - 490
RDLAGWSTMARSQLTATSASRVQMILVPQPPE                                          491 - 522
//

Publication (5)

PMID Year Title
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.