Property Summary

NCBI Gene PubMed Count 29
PubMed Score 54.94
PubTator Score 11.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 2.3e-92
osteosarcoma 7950 1.4e-03
interstitial cystitis 2312 1.6e-03
primary Sjogren syndrome 735 1.6e-03
invasive ductal carcinoma 2951 2.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Cancer 2499 3.216 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
interstitial cystitis 2.000 1.6e-03
invasive ductal carcinoma 1.100 2.5e-02
osteosarcoma -1.265 1.4e-03
primary Sjogren syndrome 1.400 1.6e-03
psoriasis 2.200 2.3e-92

Gene RIF (26)

AA Sequence

MRWCLLLIWAQGLRQAPLASGMMTGTIETTGNISAEKGGSIILQCHLSSTTAQVTQVNWEQQDQLLAICN      1 - 70
ADLGWHISPSFKDRVAPGPGLGLTLQSLTVNDTGEYFCIYHTYPDGTYTGRIFLEVLESSVAEHGARFQI     71 - 140
PLLGAMAATLVVICTAVIVVVALTRKKKALRIHSVEGDLRRKSAGQEEWSPSAPSPPGSCVQAEAAPAGL    141 - 210
CGEQRGEDCAELHDYFNVLSYRSLGNCSFFTETG                                        211 - 244
//

Text Mined References (31)

PMID Year Title