Property Summary

NCBI Gene PubMed Count 22
Grant Count 16
Funding $1,984,244.75
PubMed Score 38.99
PubTator Score 11.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.265 0.001
interstitial cystitis 2.000 0.002
primary Sjogren syndrome 1.400 0.002
invasive ductal carcinoma 1.100 0.025
psoriasis 2.200 0.000

Gene RIF (19)

PMID Text
26842126 implying that TIGIT exerts immunosuppressive effects by competing with DNAM-1 for the same ligand, CD155
26741490 These findings identify TIGIT as a novel marker of dysfunctional HIV-specific T cells
26735971 This study shows that HBZ-induced TIGIT plays a pivotal role in attenuating host immune responses and shaping a microenvironment favorable to human T-cell leukemia virus type 1.
26250578 TIGIT-positive circulating follicular helper T cells display robust B-cell help functions: potential role in sickle cell alloimmunization.
26171588 a novel mechanism that links TIGIT expression with NK-cell functional heterogeneity, and this mechanism might partially explain why individuals have different susceptibilities to infection, autoimmune disease, and cancer.
25994968 Human regulatory T cells expressing the receptors TIGIT and CD226 display widely divergent phenotypes in regard to expansion and activation.
25866972 TIGIT and PD-1 blockade additively increased proliferation, cytokine production, and degranulation of tumor-antigen-specific CD8 T cells and CD8 TILs. TIGIT and PD-1 regulate the expansion and function of these T cells in melanoma.
25762785 the TIGIT/FCRL3 combination allows reliable identification of Helios(+) Treg cells even in highly activated conditions in vitro as well as in PBMCs of autoimmune patients.
25680274 The results identify a bacterium-dependent, tumor-immune evasion mechanism in which tumors exploit the Fap2 protein of F. nucleatum to inhibit immune cell activity via TIGIT.
25465800 Findings suggest that TIGIT is a key checkpoint inhibitor of chronic antiviral and antitumor responses through impairing CD226 function when disrupting its homodimerization.
More...

AA Sequence

MRWCLLLIWAQGLRQAPLASGMMTGTIETTGNISAEKGGSIILQCHLSSTTAQVTQVNWEQQDQLLAICN      1 - 70
ADLGWHISPSFKDRVAPGPGLGLTLQSLTVNDTGEYFCIYHTYPDGTYTGRIFLEVLESSVAEHGARFQI     71 - 140
PLLGAMAATLVVICTAVIVVVALTRKKKALRIHSVEGDLRRKSAGQEEWSPSAPSPPGSCVQAEAAPAGL    141 - 210
CGEQRGEDCAELHDYFNVLSYRSLGNCSFFTETG                                        211 - 244
//

Publication (24)

PMID Year Title
26842126 2016 Immunoreceptor TIGIT inhibits the cytotoxicity of human cytokine-induced killer cells by interacting with CD155.
26741490 2016 TIGIT Marks Exhausted T Cells, Correlates with Disease Progression, and Serves as a Target for Immune Restoration in HIV and SIV Infection.
26735971 2016 HTLV-1 bZIP Factor Impairs Anti-viral Immunity by Inducing Co-inhibitory Molecule, T Cell Immunoglobulin and ITIM Domain (TIGIT).
26250578 2015 TIGIT-positive circulating follicular helper T cells display robust B-cell help functions: potential role in sickle cell alloimmunization.
26171588 2015 TIGIT expression levels on human NK cells correlate with functional heterogeneity among healthy individuals.
25994968 2015 Divergent Phenotypes of Human Regulatory T Cells Expressing the Receptors TIGIT and CD226.
25866972 2015 TIGIT and PD-1 impair tumor antigen-specific CD8? T cells in melanoma patients.
25762785 2015 Coexpression of TIGIT and FCRL3 identifies Helios+ human memory regulatory T cells.
25680274 2015 Binding of the Fap2 protein of Fusobacterium nucleatum to human inhibitory receptor TIGIT protects tumors from immune cell attack.
25465800 2014 The immunoreceptor TIGIT regulates antitumor and antiviral CD8(+) T cell effector function.
More...