Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 8.4e-19
Disease Target Count Z-score Confidence
Infertility 188 3.281 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.800 8.4e-19

AA Sequence

MVDKDTERDIEMKRQLRRLRELHLYSTWKKYQEAMKTSLGVPQRGDLEDLEEHLPGQTVSEEATGVHMMQ      1 - 70
VDPATPAKKLEDSTITGSHQQMSASPSSAPAEEATEKTKVEEEVKTRKPKKKTRKPSKKSRWNVLKCWDI     71 - 140
FNIF                                                                      141 - 144
//

Text Mined References (5)

PMID Year Title