Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Infertility 163 3.296 1.6
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.800 0.000

Synonym

Accession Q494X1 A4IF33 B2RUV5 B7ZW12
Symbols NY-REN-7-like

Gene

 Compartment GO Term (0)

AA Sequence

MVDKDTERDIEMKRQLRRLRELHLYSTWKKYQEAMKTSLGVPQRGDLEDLEEHLPGQTVSEEATGVHMMQ      1 - 70
VDPATPAKKLEDSTITGSHQQMSASPSSAPAEEATEKTKVEEEVKTRKPKKKTRKPSKKSRWNVLKCWDI     71 - 140
FNIF                                                                      141 - 144
//

Text Mined References (5)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.