Protein FAM153C

Property Summary

NCBI Gene PubMed Count	4
PubMed Score	0.02

Knowledge Summary

Patent

No data available

TINX Plot

Disease (2)

Expression Atlas
JensenLab Text Mining

Disease	Target Count	P-value
psoriasis	6694	8.4e-19

Disease	Target Count	Z-score	Confidence
Infertility	188	3.281	1.6

Expression

Specificity
Differential

Differential Expression (1)

Disease	log2 FC	p
psoriasis	-1.800	8.4e-19

Brain - Cerebellar Hemisphere 18,015

Brain - Cerebellum 17,983

Testis 18,518

Spleen 17,614

Pituitary 18,147

Brain - Cortex 18,039

Brain - Frontal Cortex (BA9) 18,069

Prostate 18,213

Brain - Nucleus accumbens (basal ganglia... 18,024

Brain - Anterior cingulate cortex (BA24) 17,989

Brain - Hippocampus 18,011

Adipose - Visceral (Omentum) 17,937

Brain - Caudate (basal ganglia) 18,001

Brain - Amygdala 18,006

Brain - Putamen (basal ganglia) 17,863

Vagina 17,834

Brain - Hypothalamus 18,169

Thyroid 18,024

Skin - Not Sun Exposed (Suprapubic) 18,081

Adrenal Gland 18,071

Skin - Sun Exposed (Lower leg) 17,968

Ovary 17,971

Pancreas 18,123

Esophagus - Gastroesophageal Junction 18,000

Small Intestine - Terminal Ileum 17,954

Esophagus - Muscularis 18,017

Esophagus - Mucosa 18,076

Lung 18,057

Heart - Atrial Appendage 17,896

Cells - EBV-transformed lymphocytes 18,186

Kidney - Cortex 17,329

Nerve - Tibial 18,007

Minor Salivary Gland 18,005

Brain - Spinal cord (cervical c-1) 17,973

Brain - Substantia nigra 17,981

Stomach 17,879

Uterus 17,618

Heart - Left Ventricle 18,006

Breast - Mammary Tissue 18,103

Colon - Sigmoid 18,089

Adipose - Subcutaneous 18,110

Artery - Coronary 17,949

Whole Blood 17,439

Artery - Aorta 17,896

Liver 18,071

Artery - Tibial 17,631

Muscle - Skeletal 17,778

Colon - Transverse 17,825

Cells - Transformed fibroblasts 17,577

Retina

Spinal cord

Testis

adipose tissue 15,837

adrenal gland 15,963

appendix 16,247

bone marrow 14,571

breast 16,063

cerebral cortex 16,630

cervix, uterine 15,871

colon 15,959

duodenum 15,975

endometrium 16,349

epididymis 15,863

esophagus 15,898

fallopian tube 16,245

gallbladder 16,333

kidney 15,917

liver 14,587

lung 16,312

lymph node 15,833

ovary 15,408

pancreas 14,070

parathyroid gland 14,769

placenta 15,937

prostate 16,460

rectum 15,705

salivary gland 14,981

seminal vesicle 15,918

skeletal muscle 14,011

skin 16,206

small intestine 16,154

smooth muscle 15,857

spleen 15,972

stomach 16,099

testis 17,936

thyroid gland 15,959

tonsil 15,400

urinary bladder 15,814

Liver and Pancreas 16,750

Digestive Tract 17,369

Urinary Tract 16,678

Endocrine System 18,159

Blood and immune system 16,909

Respiratory system 16,393

Female tissues 17,400

Male tissues 17,142

Skin and soft tissues 17,230

Nervous System 16,725

See source...

See source...

Synonym

Accession	Q494X1 A4IF33 B2RUV5 B7ZW12
Symbols	NY-REN-7-like

Gene

FAM153C

UniProt Keyword (3)

Complete proteome 20,231

Reference proteome 20,231

Alternative splicing 10,528

Compartment GO Term (0)

HCA RNA Cell Line (40)

A-431 16,131

A549 15,174

AF22 16,160

BEWO 16,726

BJ hTERT+ 15,353

BJ hTERT+ SV40 Large T+ 15,609

CAPAN-2 16,102

Daudi 15,753

EFO-21 17,301

HaCaT 16,515

See all...

AA Sequence

MVDKDTERDIEMKRQLRRLRELHLYSTWKKYQEAMKTSLGVPQRGDLEDLEEHLPGQTVSEEATGVHMMQ      1 - 70
VDPATPAKKLEDSTITGSHQQMSASPSSAPAEEATEKTKVEEEVKTRKPKKKTRKPSKKSRWNVLKCWDI     71 - 140
FNIF                                                                      141 - 144
//

Text Mined References (5)

Summary
Details

	PMID	Year	Title