Property Summary

NCBI Gene PubMed Count 27
PubMed Score 87.74
PubTator Score 11.50

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q494W8 A8KAB9
Symbols D-10
CHRNA7
CHRNA7-DR1

Gene

  Ortholog (1)

Species Source Disease
Pig OMA Inparanoid

Gene RIF (26)

AA Sequence

MQKYCIYQHFQFQLLIQHLWIAANCDIADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFD      1 - 70
VQHCKLKFGSWSYGGWSLDLQMQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRT     71 - 140
LYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFAST    141 - 210
MIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHKQRRCSLASVE    211 - 280
MSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEV    281 - 350
RYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPNFVEAVSKDFA            351 - 412
//

Text Mined References (28)

PMID Year Title