Property Summary

NCBI Gene PubMed Count 5
PubMed Score 4.18
PubTator Score 2.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
nasopharyngeal carcinoma 1058 3.8e-07
ependymoma 4679 4.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Facial paralysis 18 3.002 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
ependymoma 2.700 4.9e-02
nasopharyngeal carcinoma -1.400 3.8e-07

Gene RIF (1)

AA Sequence

MSEIPSTIVSKNMTNDKNSLESMNISSSSSTEENPKKQARKNEEHGPDPSANPFHLSGDVDFFLLRDQER      1 - 70
NKALSERQQQKTMRVHQKMTYSSKVSAKHTSLRRQLQLEDKQEDLEARAEAEHQRAFRDYTTWKLTLTKE     71 - 140
KNVEPENMSGYIKQKRQMFLLQYALDVKRREIQRLETLATKEEARLERAEKSLEKDAALFDEFVRENDCS    141 - 210
SVQAMRAAEKETKAKIEKILEIRDLTTQIVNIKSEISRFEDTLKHYKVYKDFLYKLSPKEWLEEQEKKHS    211 - 280
FLKKAKEVSEASKESSVNSTPGDKGPGIKGKASSMWAKEGQGTKKPWRFLQTMRLGRSPSYLSSPQQGSQ    281 - 350
PSESSGGDSRGSNSPIPPTQEDTDSDGEEPQLYFTEPQQLLDVFRELEEQNLSLIQNSQETEKTLEELSH    351 - 420
TLKHTQIRMDREVNQLKQWVTTMMMSITKEEDTAAELELKARVFHFGEYKGDQQDKLLESLNCKVLDVYR    421 - 490
HCTGTQQEANLGTVQMLTIIEHQLDELLENLEHVPQVKIEQAERAKEKERRIRLREEKLQMQKILQEEHL    491 - 560
QRARARAQAEIKKKRGRTLVCRSRPPAHRIKQQSEHTLMDKEEEELLFFFT                       561 - 611
//

Text Mined References (5)

PMID Year Title