Property Summary

NCBI Gene PubMed Count 5
PubMed Score 4.18
PubTator Score 2.95

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
posterior fossa group B ependymoma 3.100 0.000
nasopharyngeal carcinoma -1.400 0.000

Gene RIF (1)

PMID Text
22011669 We confirmed that the expression of CCDC37 in squamous cell carcinoma is regulated by DNA methylation of its specific promoter region.

AA Sequence

MSEIPSTIVSKNMTNDKNSLESMNISSSSSTEENPKKQARKNEEHGPDPSANPFHLSGDVDFFLLRDQER      1 - 70
NKALSERQQQKTMRVHQKMTYSSKVSAKHTSLRRQLQLEDKQEDLEARAEAEHQRAFRDYTTWKLTLTKE     71 - 140
KNVEPENMSGYIKQKRQMFLLQYALDVKRREIQRLETLATKEEARLERAEKSLEKDAALFDEFVRENDCS    141 - 210
SVQAMRAAEKETKAKIEKILEIRDLTTQIVNIKSEISRFEDTLKHYKVYKDFLYKLSPKEWLEEQEKKHS    211 - 280
FLKKAKEVSEASKESSVNSTPGDKGPGIKGKASSMWAKEGQGTKKPWRFLQTMRLGRSPSYLSSPQQGSQ    281 - 350
PSESSGGDSRGSNSPIPPTQEDTDSDGEEPQLYFTEPQQLLDVFRELEEQNLSLIQNSQETEKTLEELSH    351 - 420
TLKHTQIRMDREVNQLKQWVTTMMMSITKEEDTAAELELKARVFHFGEYKGDQQDKLLESLNCKVLDVYR    421 - 490
HCTGTQQEANLGTVQMLTIIEHQLDELLENLEHVPQVKIEQAERAKEKERRIRLREEKLQMQKILQEEHL    491 - 560
QRARARAQAEIKKKRGRTLVCRSRPPAHRIKQQSEHTLMDKEEEELLFFFT                       561 - 611
//

Text Mined References (5)

PMID Year Title
23569216 2013 The MIA complex is a conserved and novel dynein regulator essential for normal ciliary motility.
22011669 2012 Genome-wide analysis of DNA methylation and the gene expression change in lung cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.