Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
chronic rhinosinusitis -1.361 4.8e-02
ependymoma 1.100 2.0e-02
medulloblastoma, large-cell -1.100 1.7e-04
nasopharyngeal carcinoma -1.900 2.1e-07
osteosarcoma -2.144 2.0e-09
ovarian cancer -1.400 1.0e-05

AA Sequence

MPPKNKEKGKKSGAQKKKKNWGADVVAESRHRLVVLEKELLRDHLALRRDEARRAKASEDQLRQRLQGVE      1 - 70
AELEGARSEGKAIYAEMSRQCHALQEDMQTRSKQLEEEVKGLRGQLEACQREAAAAREEAEQALGERDQA     71 - 140
LAQLRAHMADMEAKYEEILHDSLDRLLAKLRAIKQQWDGAALRLHARHKEQQRQFGLTPPGSLRPPAPSL    141 - 210
//

Text Mined References (4)

PMID Year Title