Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -2.144 0.000
posterior fossa group B ependymoma 2.500 0.000
medulloblastoma, large-cell -1.100 0.000
nasopharyngeal carcinoma -1.900 0.000
ovarian cancer -1.400 0.000
chronic rhinosinusitis -1.361 0.048

Synonym

Accession Q494R4
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MPPKNKEKGKKSGAQKKKKNWGADVVAESRHRLVVLEKELLRDHLALRRDEARRAKASEDQLRQRLQGVE      1 - 70
AELEGARSEGKAIYAEMSRQCHALQEDMQTRSKQLEEEVKGLRGQLEACQREAAAAREEAEQALGERDQA     71 - 140
LAQLRAHMADMEAKYEEILHDSLDRLLAKLRAIKQQWDGAALRLHARHKEQQRQFGLTPPGSLRPPAPSL    141 - 210
//

Text Mined References (4)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.