Property Summary

NCBI Gene PubMed Count 18
PubMed Score 31.16
PubTator Score 201.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
active Crohn's disease 1.690 4.7e-04
active ulcerative colitis 1.268 1.7e-02
adult high grade glioma 1.400 9.5e-04
Astrocytoma, Pilocytic 1.800 1.3e-09
Atopic dermatitis 1.100 6.6e-04
atypical teratoid / rhabdoid tumor 1.500 1.9e-05
ependymoma 1.700 1.0e-10
gastric carcinoma 1.400 3.4e-02
glioblastoma 1.400 5.8e-08
inflammatory breast cancer 1.400 8.8e-03
interstitial cystitis 1.200 7.4e-04
intraductal papillary-mucinous neoplasm ... 1.400 1.5e-02
juvenile dermatomyositis 2.911 3.0e-16
osteosarcoma -1.672 1.1e-03
ovarian cancer 1.100 2.7e-04
pancreatic cancer 1.100 8.8e-03
primary pancreatic ductal adenocarcinoma 1.302 2.7e-03
primary Sjogren syndrome 1.600 2.1e-04
psoriasis 1.600 3.1e-87
subependymal giant cell astrocytoma 1.985 5.7e-03

Gene RIF (8)

AA Sequence

MAVPGSFPLLVEGSWGPDPPKNLNTKLQMYFQSPKRSGGGECEVRQDPRSPSRFLVFFYPEDVRQKVLER      1 - 70
KNHELVWQGKGTFKLTVQLPATPDEIDHVFEEELLTKESKTKEDVKEPDVSEELDTKLPLDGGLDKMEDI     71 - 140
PEECENISSLVAFENLKANVTDIMLILLVENISGLSNDDFQVEIIRDFDVAVVTFQKHIDTIRFVDDCTK    141 - 210
HHSIKQLQLSPRLLEVTNTIRVENLPPGADDYSLKLFFENPYNGGGRVANVEYFPEESSALIEFFDRKVL    211 - 280
DTIMATKLDFNKMPLSVFPYYASLGTALYGKEKPLIKLPAPFEESLDLPLWKFLQKKNHLIEEINDEMRR    281 - 350
CHCELTWSQLSGKVTIRPAATLVNEGRPRIKTWQADTSTTLSSIRSKYKVNPIKVDPTMWDTIKNDVKDD    351 - 420
RILIEFDTLKEMVILAGKSEDVQSIEVQVRELIESTTQKIKREEQSLKEKMIISPGRYFLLCHSSLLDHL    421 - 490
LTECPEIEICYDRVTQHLCLKGPSADVYKAKCEIQEKVYTMAQKNIQVSPEIFQFLQQVNWKEFSKCLFI    491 - 560
AQKILALYELEGTTVLLTSCSSEALLEAEKQMLSALNYKRIEVENKEVLHGKKWKGLTHNLLKKQNSSPN    561 - 630
TVIINELTSETTAEVIITGCVKEVNETYKLLFNFVEQNMKIERLVEVKPSLVIDYLKTEKKLFWPKIKKV    631 - 700
NVQVSFNPENKQKGILLTGSKTEVLKAVDIVKQVWDSVCVKSVHTDKPGAKQFFQDKARFYQSEIKRLFG    701 - 770
CYIELQENEVMKEGGSPAGQKCFSRTVLAPGVVLIVQQGDLARLPVDVVVNASNEDLKHYGGLAAALSKA    771 - 840
AGPELQADCDQIVKREGRLLPGNATISKAGKLPYHHVIHAVGPRWSGYEAPRCVYLLRRAVQLSLCLAEK    841 - 910
YKYRSIAIPAISSGVFGFPLGRCVETIVSAIKENFQFKKDGHCLKEIYLVDVSEKTVEAFAEAVKTVFKA    911 - 980
TLPDTAAPPGLPPAAAGPGKTSWEKGSLVSPGGLQMLLVKEGVQNAKTDVVVNSVPLDLVLSRGPLSKSL    981 - 1050
LEKAGPELQEELDTVGQGVAVSMGTVLKTSSWNLDCRYVLHVVAPEWRNGSTSSLKIMEDIIRECMEITE   1051 - 1120
SLSLKSIAFPAIGTGNLGFPKNIFAELIISEVFKFSSKNQLKTLQEVHFLLHPSDHENIQAFSDEFARRA   1121 - 1190
NGNLVSDKIPKAKDTQGFYGTVSSPDSGVYEMKIGSIIFQVASGDITKEEADVIVNSTSNSFNLKAGVSK   1191 - 1260
AILECAGQNVERECSQQAQQRKNDYIITGGGFLRCKNIIHVIGGNDVKSSVSSVLQECEKKNYSSICLPA   1261 - 1330
IGTGNAKQHPDKVAEAIIDAIEDFVQKGSAQSVKKVKVVIFLPQVLDVFYANMKKREGTQLSSQQSVMSK   1331 - 1400
LASFLGFSKQSPQKKNHLVLEKKTESATFRVCGENVTCVEYAISWLQDLIEKEQCPYTSEDECIKDFDEK   1401 - 1470
EYQELNELQKKLNINISLDHKRPLIKVLGISRDVMQARDEIEAMIKRVRLAKEQESRADCISEFIEWQYN   1471 - 1540
DNNTSHCFNKMTNLKLEDARREKKKTVDVKINHRHYTVNLNTYTATDTKGHSLSVQRLTKSKVDIPAHWS   1541 - 1610
DMKQQNFCVVELLPSDPEYNTVASKFNQTCSHFRIEKIERIQNPDLWNSYQAKKKTMDAKNGQTMNEKQL   1611 - 1680
FHGTDAGSVPHVNRNGFNRSYAGKNAVAYGKGTYFAVNANYSANDTYSRPDANGRKHVYYVRVLTGIYTH   1681 - 1750
GNHSLIVPPSKNPQNPTDLYDTVTDNVHHPSLFVAFYDYQAYPEYLITFRK                      1751 - 1801
//

Text Mined References (25)

PMID Year Title