Property Summary

NCBI Gene PubMed Count 13
PubMed Score 14.17
PubTator Score 213.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
osteosarcoma 7950 3.1e-04
primary Sjogren syndrome 735 5.2e-03
interstitial cystitis 2312 1.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Heart conduction disease 83 0.0 1.7
Disease Target Count Z-score Confidence
Diphtheria 40 3.967 2.0
Syphilis 17 3.666 1.8
Arts syndrome 26 3.163 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
interstitial cystitis 2.000 1.3e-02
osteosarcoma -1.365 3.1e-04
primary Sjogren syndrome 1.200 5.2e-03

Gene RIF (4)

AA Sequence

MAAPGPLPAAALSPGAPTPRELMHGVAGVTSRAGRDREAGSVLPAGNRGARKASRRSSSRSMSRDNKFSK      1 - 70
KDCLSIRNVVASIQTKEGLNLKLISGDVLYIWADVIVNSVPMNLQLGGGPLSRAFLQKAGPMLQKELDDR     71 - 140
RRETEEKVGNIFMTSGCNLDCKAVLHAVAPYWNNGAETSWQIMANIIKKCLTTVEVLSFSSITFPMIGTG    141 - 210
SLQFPKAVFAKLILSEVFEYSSSTRPITSPLQEVHFLVYTNDDEGCQAFLDEFTNWSRINPNKARIPMAG    211 - 280
DTQGVVGTVSKPCFTAYEMKIGAITFQVATGDIATEQVDVIVNSTARTFNRKSGVSRAILEGAGQAVESE    281 - 350
CAVLAAQPHRDFIITPGGCLKCKIIIHVPGGKDVRKTVTSVLEECEQRKYTSVSLPAIGTGNAGKNPITV    351 - 420
ADNIIDAIVDFSSQHSTPSLKTVKVVIFQPELLNIFYDSMKKRDLSASLNFQSTFSMTTCNLPEHWTDMN    421 - 490
HQLFCMVQLEPGQSEYNTIKDKFTRTCSSYAIEKIERIQNAFLWQSYQVKKRQMDIKNDHKNNERLLFHG    491 - 560
TDADSVPYVNQHGFNRSCAGKNAVSYGKGTYFAVDASYSAKDTYSKPDSNGRKHMYVVRVLTGVFTKGRA    561 - 630
GLVTPPPKNPHNPTDLFDSVTNNTRSPKLFVVFFDNQAYPEYLITFTA                          631 - 678
//

Text Mined References (16)

PMID Year Title