Property Summary

Ligand Count 1
NCBI Gene PubMed Count 4
PubMed Score 0.96
PubTator Score 12.71

Knowledge Summary

Patent (10,231)

TINX Plot

  Disease (2)

Disease Target Count
Muscle relaxation, function 8
Disease Target Count P-value
osteosarcoma 7950 4.5e-07

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.283 4.5e-07

Gene RIF (2)

AA Sequence

MMALWSLLHLTFLGFSITLLLVHGQGFQGTAAIWPSLFNVNLSKKVQESIQIPNNGSAPLLVDVRVFVSN      1 - 70
VFNVDILRYTMSSMLLLRLSWLDTRLAWNTSAHPRHAITLPWESLWTPRLTILEALWVDWRDQSPQARVD     71 - 140
QDGHVKLNLALATETNCNFELLHFPRDHSNCSLSFYALSNTAMELEFQAHVVNEIVSVKREYVVYDLKTQ    141 - 210
VPPQQLVPCFQVTLRLKNTALKSIIALLVPAEALLLADVCGGLLPLRAIERIGYKVTLLLSYLVLHSSLV    211 - 280
QALPSSSSCNPLLIYYFTILLLLLFLSTIETVLLAGLLARGNLGAKSGPSPAPRGEQREHGNPGPHPAEE    281 - 350
PSRGVKGSQRSWPETADRIFFLVYVVGVLCTQFVFAGIWMWAACKSDAAPGEAAPHGRRPRL            351 - 412
//

Text Mined References (7)

PMID Year Title