Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.96
PubTator Score 12.71

Knowledge Summary

Patent (10,231)

TINX Plot

  Disease Sources (2)

Disease Target Count
Muscle relaxation, function 8
Disease Target Count P-value
osteosarcoma 7933 4.54160282768772E-7

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.283 0.000

Synonym

Accession Q401N2 Q2TB29 Q6ZWK3 Q86YW4
Symbols L2
ZAC
ZAC1
LGICZ
LGICZ1

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
16083862 analysis of ligand-gated ion-channel receptor L2 in central nervous system
15286800 ZAC expression was studied in transgenic mice.

AA Sequence

MMALWSLLHLTFLGFSITLLLVHGQGFQGTAAIWPSLFNVNLSKKVQESIQIPNNGSAPLLVDVRVFVSN      1 - 70
VFNVDILRYTMSSMLLLRLSWLDTRLAWNTSAHPRHAITLPWESLWTPRLTILEALWVDWRDQSPQARVD     71 - 140
QDGHVKLNLALATETNCNFELLHFPRDHSNCSLSFYALSNTAMELEFQAHVVNEIVSVKREYVVYDLKTQ    141 - 210
VPPQQLVPCFQVTLRLKNTALKSIIALLVPAEALLLADVCGGLLPLRAIERIGYKVTLLLSYLVLHSSLV    211 - 280
QALPSSSSCNPLLIYYFTILLLLLFLSTIETVLLAGLLARGNLGAKSGPSPAPRGEQREHGNPGPHPAEE    281 - 350
PSRGVKGSQRSWPETADRIFFLVYVVGVLCTQFVFAGIWMWAACKSDAAPGEAAPHGRRPRL            351 - 412
//

Text Mined References (7)

PMID Year Title
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16083862 2005 Cloning and expression of ligand-gated ion-channel receptor L2 in central nervous system.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12381728 2003 A novel class of ligand-gated ion channel is activated by Zn2+.