Property Summary

NCBI Gene PubMed Count 4
Grant Count 12
R01 Count 6
Funding $1,227,000.25
PubMed Score 0.96
PubTator Score 12.71

Knowledge Summary

Patent (10,231)

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -1.283 0.000

Gene RIF (2)

PMID Text
16083862 analysis of ligand-gated ion-channel receptor L2 in central nervous system
15286800 ZAC expression was studied in transgenic mice.

AA Sequence

MMALWSLLHLTFLGFSITLLLVHGQGFQGTAAIWPSLFNVNLSKKVQESIQIPNNGSAPLLVDVRVFVSN      1 - 70
VFNVDILRYTMSSMLLLRLSWLDTRLAWNTSAHPRHAITLPWESLWTPRLTILEALWVDWRDQSPQARVD     71 - 140
QDGHVKLNLALATETNCNFELLHFPRDHSNCSLSFYALSNTAMELEFQAHVVNEIVSVKREYVVYDLKTQ    141 - 210
VPPQQLVPCFQVTLRLKNTALKSIIALLVPAEALLLADVCGGLLPLRAIERIGYKVTLLLSYLVLHSSLV    211 - 280
QALPSSSSCNPLLIYYFTILLLLLFLSTIETVLLAGLLARGNLGAKSGPSPAPRGEQREHGNPGPHPAEE    281 - 350
PSRGVKGSQRSWPETADRIFFLVYVVGVLCTQFVFAGIWMWAACKSDAAPGEAAPHGRRPRL            351 - 412
//

Text Mined References (7)

PMID Year Title
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16083862 2005 Cloning and expression of ligand-gated ion-channel receptor L2 in central nervous system.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12381728 2003 A novel class of ligand-gated ion channel is activated by Zn2+.