Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.72
PubTator Score 0.75

Knowledge Summary

Patent

No data available

TINX Plot

Expression

 GO Process (1)

 Compartment GO Term (0)

Protein-protein Interaction (12)

Gene RIF (1)

AA Sequence

MLQCRPAQEFSFGPRALKDALVSTDAALQQLYVSAFSPAERLFLAEAYNPQRTLFCTLLIRTGFDWLLSR      1 - 70
PEAPEDFQTFHASLQHRKPRLARKHIYLQPIDLSEEPVGSSLLHQLCSCTEAFFLGLRVKCLPSVAAASI     71 - 140
RCSSRPSRDSDRLQLHTDGILSFLKNNKPGDALCVLGLTLSDLYPHEAWSFTFSKFLPGHEVGVCSFARF    141 - 210
SGEFPKSGPSAPDLALVEAAADGPEAPLQDRGWALCFSALGMVQCCKVTCHELCHLLGLGNCRWLRCLMQ    211 - 280
GALSLDEALRRPLDLCPICLRKLQHVLGFRLIERYQRLYTWTQAVVGTWPSQEAGEPSVWEDTPPASADS    281 - 350
GMCCESDSEPGTSVSEPLTPDAGSHTFASGPEEGLSYLAASEAPLPPGGPAEAIKEHERWLAMCIQALQR    351 - 420
EVAEEDLVQVDRAVDALDRWEMFTGQLPATRQDPPSSRDSVGLRKVLGDKFSSLRRKLSARKLARAESAP    421 - 490
RPWDGEES                                                                  491 - 498
//

Text Mined References (7)

PMID Year Title