Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q3ZLR7
Symbols SPT20L
FAM48B1

Gene

PANTHER Protein Class (1)

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MDRDLEQALDRAENIIEIAQQRPPRRRYSPRAGKTLQEKLYDIYVEECGKEPEDPQELRSNVNLLEKLVR      1 - 70
RESLPCLLVNLYPGNQGYSVMLQREDGSFAETIRLPYEERALLDYLDAEELPPALGDVLDKASVNIFHSG     71 - 140
CVIVEVRDYRQSSNMQPPGYQSRHILLRPTMQTLAHDVKMMTRDGQKWSQEDKLQLESQLILATAEPLCL    141 - 210
DPSVAVACTANRLLYNKQKMNTDPMKRCLQRYSWPSVKPQQEQSDCPPPPELRVSTSGQKEERKVGQPCE    211 - 280
LNIAKAGSCVDTWKGRPCDLAVPSEVDVEKLAKGYQSVTAADPQLPVWPAQEVEDPFGFALEAGCQAWDT    281 - 350
KPSIMQSFNDPLLCGKIRPRKKARQKSQKSPWQPFPDDHSACLRPGSETDAGRAVSQAQESVQSKVKGPG    351 - 420
KMSHSSSGPASVSQLSSWKTPEQPDPVWVQSSVSGKGEKHPPPRTQLPSSSGKISSGNSFPPQQAGSPLK    421 - 490
PAAPAAAASAAPSHSQKPSVPLIQASRPCPAAQPPTKFIKIAPAIQLRTGSTGLKAINVEGPVQGAQALG    491 - 560
SSFKPVQAPGSGAPAPAGISGSDLQSSGGPLPDARPGAVQASSPAPLQFFLNTPEGLRPLTLLQVPQGSA    561 - 630
VLTGPQQQSHQLVSLQQLQQPTAAHPPQPGPQGSALGLSTQGQAFPAQQLLKVNPTRARSGLQPQPQPAV    631 - 700
LSLLGSAQVPQQGVQLPSVLRQQQPQPQPPKLQLQPQWQPKPRQEQPQSQQQQPQHIQLQTQQLRVLQQP    701 - 770
QHIQLQTQQLRVLQQPVFLATGAVQIVQPHPGVQVGSQLVDQRKEGKPTPPAP                     771 - 823
//

Text Mined References (2)

PMID Year Title
19114550 2009 The human SPT20-containing SAGA complex plays a direct role in the regulation of endoplasmic reticulum stress-induced genes.
15772651 2005 The DNA sequence of the human X chromosome.