Property Summary

NCBI Gene PubMed Count 11
PubMed Score 10.39
PubTator Score 4.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -1.400 1.5e-02
atypical teratoid / rhabdoid tumor 1.400 8.5e-04
colon cancer -2.200 3.4e-02
ependymoma -1.300 2.7e-02
gastric cancer 1.100 7.1e-03
invasive ductal carcinoma -1.166 2.4e-04
lung adenocarcinoma -1.200 2.1e-09
malignant mesothelioma 1.200 3.9e-05
mucosa-associated lymphoid tissue lympho... 2.475 6.4e-03
non-small cell lung cancer -1.284 1.1e-10
pancreatic cancer 1.500 5.8e-03
pancreatic carcinoma 1.500 5.8e-03
periodontitis -1.100 3.8e-31
pituitary cancer -2.000 3.9e-04
spina bifida -1.473 2.3e-02
subependymal giant cell astrocytoma -1.257 3.9e-02

Synonym

Accession Q3ZCW2 B2RBG8 D6W5E8 Q6P5T6 Q9P005
Symbols GRP
HSPC159

Gene

PANTHER Protein Class (1)

PDB

2JJ6   3B9C  

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Gene RIF (3)

AA Sequence

MAGSVADSDAVVKLDDGHLNNSLSSPVQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIVDLNPESFAIS      1 - 70
LTCGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQPFRVEILCEHPRFRVFVD     71 - 140
GHQLFDFYHRIQTLSAIDTIKINGDLQITKLG                                          141 - 172
//

Text Mined References (19)

PMID Year Title