Property Summary

NCBI Gene PubMed Count 11
PubMed Score 10.36
PubTator Score 4.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Gene RIF (3)

PMID Text
18320588 Galectin-related protein is a novel protein that has a close similarity to galectin sequences but is not a member of the galectin family because of its lack of lactose-binding activity. The crystal structure has been solved.
18219197 CCL13 and HSPC159 mRNA expressions in PBMC are up-regulated specifically in MCNS patients during the nephrosis phase.
16682780 Galectin-related protein named GRP comprises only one conserved carbohydrate-recognition domain with 38 additional N-terminal residues. The crystals belong to the monoclinic space group C2.

AA Sequence

MAGSVADSDAVVKLDDGHLNNSLSSPVQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIVDLNPESFAIS      1 - 70
LTCGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQPFRVEILCEHPRFRVFVD     71 - 140
GHQLFDFYHRIQTLSAIDTIKINGDLQITKLG                                          141 - 172
//

Text Mined References (19)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18433051 2008 Crystal structure of the putative carbohydrate recognition domain of human galectin-related protein.
18320588 2008 Crystal structure of the C-terminal conserved domain of human GRP, a galectin-related protein, reveals a function mode different from those of galectins.
18219197 2008 Gene expression profiling of peripheral blood mononuclear cells from patients with minimal change nephrotic syndrome by cDNA microarrays.
More...