Property Summary

NCBI Gene PubMed Count 3
PubMed Score 189.24
PubTator Score 8.17

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q3ZCV2 B7WPL2 Q8N7Y9
Symbols LEM
C1orf177

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MRESQDAAGAHGWNRVGSTATKWFTGAPFGVQSHRFDISAVYPNWKKFSTFTEAPYSTRYSTQVSHIGPG      1 - 70
TYSSKETCFSKKKLMKEVDTGWAKAQEATRLTQLPHFQYQAIMKEKRLKEQKLGPGSYNLKDFLEQLREK     71 - 140
PCSTRGLLSSGEVRFRGLTGNYYPGPGNYGEKGNPYTKLEENAWNRSHSEGLMCRMSNKPHPRPYQGSGL    141 - 210
GPGTYFFKSDLETYVARSVGTRGPYDTFSGDRSKPLPYGHYSMQKKKPRELMNFKSFVEELNSHHNKKHG    211 - 280
VFSKLPRNPKTPTERIYWANLSQCPRTLATSGPSFWLPQEKKCKPVNQPPFLLTSKGSGAKACQMIMGSW    281 - 350
NPVGVGRYLNTWLMETKDRRQRYRSLFLSGSKRYLSDLARDMLMQERITPFTKGKCPPTVDYNSDPTP      351 - 418
//

Text Mined References (8)

PMID Year Title