Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.69
PubTator Score 0.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
glioblastoma multiforme 347 1.2436922569564E-12
tuberculosis and treatment for 6 months 686 7.09748846931545E-6
hepatocellular carcinoma 550 1.64184877306172E-5
nasopharyngeal carcinoma 1056 9.59356312060645E-5
sonic hedgehog group medulloblastoma 1482 1.86305188756818E-4
atypical teratoid/rhabdoid tumor 1095 2.38197517347532E-4
primitive neuroectodermal tumor 3031 5.85204852110411E-4
pilocytic astrocytoma 3086 8.05993757595647E-4
gastric cancer 436 0.00257274069661607
ovarian cancer 8492 0.00591811657863636
pancreatic cancer 2300 0.0102914593664087
pancreatic carcinoma 567 0.0102914593664087
aldosterone-producing adenoma 664 0.0112860053121356
osteosarcoma 7933 0.0331019991789657
acute myeloid leukemia 785 0.0421656377736601
spina bifida 1064 0.0469664223876046

Expression

Synonym

Accession Q3ZCT1 Q0VF43 Zfp-260
Symbols PEX1
OZRF1
ZFP260

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Pig OMA EggNOG

Pathway (1)

Gene RIF (1)

PMID Text
16166646 Zfp260 is a novel transcriptional regulator in normal and pathological heart development and a nuclear effector of alpha1-adrenergic signaling

AA Sequence

MIGMLESLQHESDLLQHDQIHTGEKPYECNECRKTFSLKQNLVEHKKMHTGEKSHECTECGKVCSRVSSL      1 - 70
TLHLRSHTGKKAYKCNKCGKAFSQKENFLSHQKHHTGEKPYECEKVSIQMPTIIRHQKNHTGTKPYACKE     71 - 140
CGKAFNGKAYLTEHEKIHTGEKPFECNQCGRAFSQKQYLIKHQNIHTGKKPFKCSECGKAFSQKENLIIH    141 - 210
QRIHTGEKPYECKGCGKAFIQKSSLIRHQRSHTGEKPYTCKECGKAFSGKSNLTEHEKIHIGEKPYKCNE    211 - 280
CGTIFRQKQYLIKHHNIHTGEKPYECNKCGKAFSRITSLIVHVRIHTGDKPYECKVCGKAFCQSSSLTVH    281 - 350
MRSHTGEKPYGCNECGKAFSQFSTLALHMRIHTGEKPYQCSECGKAFSQKSHHIRHQRIHTH            351 - 412
//

Text Mined References (9)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16166646 2005 The zinc finger-only protein Zfp260 is a novel cardiac regulator and a nuclear effector of alpha1-adrenergic signaling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7829101 1994 Isolation of novel and known genes from a human fetal cochlear cDNA library using subtractive hybridization and differential screening.