Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.60
PubTator Score 0.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
acute myeloid leukemia -2.100 4.2e-02
aldosterone-producing adenoma -1.430 1.1e-02
Astrocytoma, Pilocytic 1.200 1.1e-03
atypical teratoid/rhabdoid tumor 1.400 2.4e-04
gastric cancer 1.700 2.6e-03
glioblastoma 1.200 5.7e-05
group 3 medulloblastoma 1.300 3.5e-02
hepatocellular carcinoma 1.800 1.6e-05
nasopharyngeal carcinoma 1.500 9.6e-05
osteosarcoma -1.019 3.3e-02
ovarian cancer 1.600 5.9e-03
pancreatic cancer 1.500 1.0e-02
pancreatic carcinoma 1.500 1.0e-02
primitive neuroectodermal tumor 1.200 5.9e-04
spina bifida -1.443 4.7e-02
tuberculosis -1.200 7.9e-03

Gene RIF (1)

AA Sequence

MIGMLESLQHESDLLQHDQIHTGEKPYECNECRKTFSLKQNLVEHKKMHTGEKSHECTECGKVCSRVSSL      1 - 70
TLHLRSHTGKKAYKCNKCGKAFSQKENFLSHQKHHTGEKPYECEKVSIQMPTIIRHQKNHTGTKPYACKE     71 - 140
CGKAFNGKAYLTEHEKIHTGEKPFECNQCGRAFSQKQYLIKHQNIHTGKKPFKCSECGKAFSQKENLIIH    141 - 210
QRIHTGEKPYECKGCGKAFIQKSSLIRHQRSHTGEKPYTCKECGKAFSGKSNLTEHEKIHIGEKPYKCNE    211 - 280
CGTIFRQKQYLIKHHNIHTGEKPYECNKCGKAFSRITSLIVHVRIHTGDKPYECKVCGKAFCQSSSLTVH    281 - 350
MRSHTGEKPYGCNECGKAFSQFSTLALHMRIHTGEKPYQCSECGKAFSQKSHHIRHQRIHTH            351 - 412
//

Text Mined References (9)

PMID Year Title