Property Summary

NCBI Gene PubMed Count 15
Grant Count 11
R01 Count 5
Funding $809,795
PubMed Score 26.38
PubTator Score 15.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 2.300 0.000
non-small cell lung cancer 1.023 0.000
ovarian cancer 1.400 0.000

Gene RIF (6)

PMID Text
23098911 the interaction of divalent metal ions with the intermembrane space domain of Tim50 (Tim50(IMS)) and the interaction of presequence peptides with Tim50(IMS) in presence of Ca(2+) ion was investigated.
21930695 Tim50 regulates 3betaHSD2 expression and activity, representing a new role for translocases in steroidogenesis.
21742040 The far-UV CD spectra of Tim50(IMS) in native and denatured states revealed that the protein has a significantly folded secondary structure consisted of alpha-helixes and beta-sheets.
21621504 TIM50, was upregulated in a non-small cell lung carcinoma cell line (H1299) that expressed the p53 mutants R175H and R273H compared to cells lacking p53.
16008839 Tim50a, a nuclear isoform of the mitochondrial Tim50, interacts with coilin, snRNPs, and SMN
15044455 Tim50 is important for both mitochondrial function and early neuronal development

AA Sequence

MAASAAVFSRLRSGLRLGSRGLCTRLATPPRRAPDQAAEIGSRGSTKAQGPQQQPGSEGPSYAKKVALWL      1 - 70
AGLLGAGGTVSVVYIFGNNPVDENGAKIPDEFDNDPILVQQLRRTYKYFKDYRQMIIEPTSPCLLPDPLQ     71 - 140
EPYYQPPYTLVLELTGVLLHPEWSLATGWRFKKRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDP    141 - 210
HGFISYRLFRDATRYMDGHHVKDISCLNRDPARVVVVDCKKEAFRLQPYNGVALRPWDGNSDDRVLLDLS    211 - 280
AFLKTIALNGVEDVRTVLEHYALEDDPLAAFKQRQSRLEQEEQQRLAELSKSNKQNLFLGSLTSRLWPRS    281 - 350
KQP                                                                       351 - 353
//

Text Mined References (20)

PMID Year Title
26289846 2016 Loss of TIM50 suppresses proliferation and induces apoptosis in breast cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
23263864 2013 Methylation-controlled J-protein MCJ acts in the import of proteins into human mitochondria.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23098911 2012 Interaction of divalent metal ions with human translocase of inner membrane of mitochondria Tim50.
22335443 2012 Interaction of presequence with human translocase of the inner membrane of mitochondria Tim50.
21930695 2011 Inner mitochondrial translocase Tim50 interacts with 3?-hydroxysteroid dehydrogenase type 2 to regulate adrenal and gonadal steroidogenesis.
21742040 2011 Expression and structural characterization of human translocase of inner membrane of mitochondria Tim50.
21621504 2011 Upregulation of the mitochondrial transport protein, Tim50, by mutant p53 contributes to cell growth and chemoresistance.
More...