Property Summary

NCBI Gene PubMed Count 16
PubMed Score 28.35
PubTator Score 15.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
non-small cell lung cancer 2890 5.8e-16
malignant mesothelioma 3232 1.4e-06
ovarian cancer 8520 1.4e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Sleeping sickness 37 3.86 1.9
3-methylglutaconic aciduria 29 3.702 1.9

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 2.300 1.4e-06
non-small cell lung cancer 1.023 5.8e-16
ovarian cancer 1.400 1.4e-04

Gene RIF (8)

AA Sequence

MAASAAVFSRLRSGLRLGSRGLCTRLATPPRRAPDQAAEIGSRGSTKAQGPQQQPGSEGPSYAKKVALWL      1 - 70
AGLLGAGGTVSVVYIFGNNPVDENGAKIPDEFDNDPILVQQLRRTYKYFKDYRQMIIEPTSPCLLPDPLQ     71 - 140
EPYYQPPYTLVLELTGVLLHPEWSLATGWRFKKRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDP    141 - 210
HGFISYRLFRDATRYMDGHHVKDISCLNRDPARVVVVDCKKEAFRLQPYNGVALRPWDGNSDDRVLLDLS    211 - 280
AFLKTIALNGVEDVRTVLEHYALEDDPLAAFKQRQSRLEQEEQQRLAELSKSNKQNLFLGSLTSRLWPRS    281 - 350
KQP                                                                       351 - 353
//

Text Mined References (21)

PMID Year Title