Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.48
PubTator Score 0.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
osteosarcoma 7933 1.56050812257214E-8
pilocytic astrocytoma 3086 5.59537740045841E-8
pediatric high grade glioma 2712 7.57909671768883E-8
acute quadriplegic myopathy 1157 1.07935456321673E-6
glioblastoma 5572 1.13987799821181E-6
interstitial cystitis 2299 3.62202264555764E-6
psoriasis 6685 1.59307781617771E-5
lung cancer 4473 2.36625590814098E-5
ovarian cancer 8492 9.16017825751807E-5
pituitary cancer 1972 1.56087091580136E-4
primary pancreatic ductal adenocarcinoma 1271 0.00147517439226188
astrocytic glioma 2241 0.00204531934271855
invasive ductal carcinoma 2950 0.00225198559842169
pancreatic cancer 2300 0.00343441169082315
ependymoma 2514 0.0126238839834209
ductal carcinoma in situ 1745 0.0172815300332262
gastric carcinoma 832 0.0343785203656402
pulmonary arterial hypertension 36 0.0373443608295984
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 1.0
Disease Target Count Z-score Confidence
Ovarian serous carcinoma 7 3.572 1.8

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma -1.300 0.002
ependymoma -1.100 0.013
psoriasis -4.000 0.000
osteosarcoma -2.788 0.000
glioblastoma -1.200 0.000
acute quadriplegic myopathy 1.026 0.000
primary pancreatic ductal adenocarcinoma -1.252 0.001
lung cancer -1.800 0.000
interstitial cystitis -2.900 0.000
pediatric high grade glioma -1.200 0.000
pilocytic astrocytoma -1.100 0.000
pulmonary arterial hypertension -1.400 0.037
gastric carcinoma -1.300 0.034
ductal carcinoma in situ 1.300 0.017
invasive ductal carcinoma 1.300 0.002
ovarian cancer 1.500 0.000
pituitary cancer -1.500 0.000
pancreatic cancer -1.300 0.003

Synonym

Accession Q3ZCQ3 Q3ZCR9 Q8NBH7
Symbols

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Chicken EggNOG Inparanoid
Anole lizard EggNOG Inparanoid

 GWAS Trait (1)

AA Sequence

MRAVPLPAPLLPLLLLALLAAPAARASRAESVSAPWPEPERESRPPPGPGPGNTTRFGSGAAGGSGSSSS      1 - 70
NSSGDALVTRISILLRDLPTLKAAVIVAFAFTTLLIACLLLRVFRSGKRLKKTRKYDIITTPAERVEMAP     71 - 140
LNEEDDEDEDSTVFDIKYR                                                       141 - 159
//

Text Mined References (6)

PMID Year Title
21160409 2011 Common human genetic variants and HIV-1 susceptibility: a genome-wide survey in a homogeneous African population.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.