Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.48
PubTator Score 0.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma -1.300 0.002
ependymoma -1.100 0.013
psoriasis -4.000 0.000
osteosarcoma -2.788 0.000
glioblastoma -1.200 0.000
acute quadriplegic myopathy 1.026 0.000
primary pancreatic ductal adenocarcinoma -1.252 0.001
lung cancer -1.800 0.000
interstitial cystitis -2.900 0.000
pediatric high grade glioma -1.200 0.000
pilocytic astrocytoma -1.100 0.000
pulmonary arterial hypertension -1.400 0.037
gastric carcinoma -1.300 0.034
ductal carcinoma in situ 1.300 0.017
invasive ductal carcinoma 1.300 0.002
ovarian cancer 1.500 0.000
pituitary cancer -1.500 0.000
pancreatic cancer -1.300 0.003

AA Sequence

MRAVPLPAPLLPLLLLALLAAPAARASRAESVSAPWPEPERESRPPPGPGPGNTTRFGSGAAGGSGSSSS      1 - 70
NSSGDALVTRISILLRDLPTLKAAVIVAFAFTTLLIACLLLRVFRSGKRLKKTRKYDIITTPAERVEMAP     71 - 140
LNEEDDEDEDSTVFDIKYR                                                       141 - 159
//

Text Mined References (6)

PMID Year Title
21160409 2011 Common human genetic variants and HIV-1 susceptibility: a genome-wide survey in a homogeneous African population.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.