Property Summary

NCBI Gene PubMed Count 15
PubMed Score 0.00
PubTator Score 21.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
acute quadriplegic myopathy 1.135 8.2e-05
glioblastoma 1.200 6.5e-03
group 4 medulloblastoma 1.700 9.3e-06
inflammatory breast cancer 1.200 3.8e-04
medulloblastoma, large-cell 1.200 5.2e-03
oligodendroglioma 1.600 6.6e-03
ovarian cancer -1.700 9.6e-07
pediatric high grade glioma 1.100 1.6e-03

Gene RIF (2)

AA Sequence

MERPDKAALNALQPPEFRNESSLASTLKTLLFFTALMITVPIGLYFTTKSYIFEGALGMSNRDSYFYAAI      1 - 70
VAVVAVHVVLALFVYVAWNEGSRQWREGKQD                                            71 - 101
//

Text Mined References (22)

PMID Year Title