Property Summary

NCBI Gene PubMed Count 18
Grant Count 14
R01 Count 11
Funding $608,967.27
PubMed Score 6.91
PubTator Score 12.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.496 0.000
ovarian cancer 1.700 0.000

Gene RIF (6)

PMID Text
26676380 Rb knockdown reversed RBEL1 depletion-induced tumor suppressive effects. In conclusion, the present results suggest that RBEL1 modulates cell proliferation and G1S transition by inhibiting Rb in osteosarcoma
25273089 work identifies RABL6A as a novel negative regulator of Rb1
23977139 Breast cancer patients with high levels of C9orf86 expression showed a significant trend towards worse survival compared to patients with low C9orf86 expression.
23572512 RBEL1A appears to function as a novel p53 negative regulator that facilitates MDM2-dependent p53 ubiquitylation and degradation.
19433581 characterization of all four RBEL1 splice variants in terms of their GTPase activities, subcellular localizations, regulations & potential functions; results indicate RBEL1 proteins are linked to cell growth & survival & possess unique characteristics
17962191 RBEL1A and RBEL1B are novel Rab-like proteins that localize in the nucleus and cytosol and may play an important role in breast tumorigenesis

AA Sequence

MFSALKKLVGSDQAPGRDKNIPAGLQSMNQALQRRFAKGVQYNMKIVIRGDRNTGKTALWHRLQGRPFVE      1 - 70
EYIPTQEIQVTSIHWSYKTTDDIVKVEVWDVVDKGKCKKRGDGLKMENDPQEAESEMALDAEFLDVYKNC     71 - 140
NGVVMMFDITKQWTFNYILRELPKVPTHVPVCVLGNYRDMGEHRVILPDDVRDFIDNLDRPPGSSYFRYA    141 - 210
ESSMKNSFGLKYLHKFFNIPFLQLQRETLLRQLETNQLDMDATLEELSVQQETEDQNYGIFLEMMEARSR    211 - 280
GHASPLAANGQSPSPGSQSPVVPAGAVSTGSSSPGTPQPAPQLPLNAAPPSSVPPVPPSEALPPPACPSA    281 - 350
PAPRRSIISRLFGTSPATEAAPPPPEPVPAAEGPATVQSVEDFVPDDRLDRSFLEDTTPARDEKKVGAKA    351 - 420
AQQDSDSDGEALGGNPMVAGFQDDVDLEDQPRGSPPLPAGPVPSQDITLSSEEEAEVAAPTKGPAPAPQQ    421 - 490
CSEPETKWSSIPASKPRRGTAPTRTAAPPWPGGVSVRTGPEKRSSTRPPAEMEPGKGEQASSSESDPEGP    491 - 560
IAAQMLSFVMDDPDFESEGSDTQRRADDFPVRDDPSDVTDEDEGPAEPPPPPKLPLPAFRLKNDSDLFGL    561 - 630
GLEEAGPKESSEEGKEGKTPSKEKKKKKKKGKEEEEKAAKKKSKHKKSKDKEEGKEERRRRQQRPPRSRE    631 - 700
RTAADELEAFLGGGAPGGRHPGGGDYEEL                                             701 - 729
//

Text Mined References (20)

PMID Year Title
26676380 2016 RBEL1 is required for osteosarcoma cell proliferation via inhibiting retinoblastoma 1.
25273089 2014 RABL6A promotes G1-S phase progression and pancreatic neuroendocrine tumor cell proliferation in an Rb1-dependent manner.
23977139 2013 Down-regulation of c9orf86 in human breast cancer cells inhibits cell proliferation, invasion and tumor growth and correlates with survival of breast cancer patients.
23572512 2013 Negative regulation of p53 by Ras superfamily protein RBEL1A.
21269460 2011 Initial characterization of the human central proteome.
19433581 2009 Identification and characterization of RBEL1 subfamily of GTPases in the Ras superfamily involved in cell growth regulation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17962191 2007 RBEL1 is a novel gene that encodes a nucleocytoplasmic Ras superfamily GTP-binding protein and is overexpressed in breast cancer.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
More...