Property Summary

NCBI Gene PubMed Count 18
PubMed Score 6.91
PubTator Score 12.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Intellectual disability 1016 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 7.9e-06
osteosarcoma 7950 6.0e-04
Disease Target Count Z-score Confidence
Apraxia 26 3.161 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.184 6.0e-04
ovarian cancer 1.100 7.9e-06

Gene RIF (6)

AA Sequence

MFSALKKLVGSDQAPGRDKNIPAGLQSMNQALQRRFAKGVQYNMKIVIRGDRNTGKTALWHRLQGRPFVE      1 - 70
EYIPTQEIQVTSIHWSYKTTDDIVKVEVWDVVDKGKCKKRGDGLKMENDPQEAESEMALDAEFLDVYKNC     71 - 140
NGVVMMFDITKQWTFNYILRELPKVPTHVPVCVLGNYRDMGEHRVILPDDVRDFIDNLDRPPGSSYFRYA    141 - 210
ESSMKNSFGLKYLHKFFNIPFLQLQRETLLRQLETNQLDMDATLEELSVQQETEDQNYGIFLEMMEARSR    211 - 280
GHASPLAANGQSPSPGSQSPVVPAGAVSTGSSSPGTPQPAPQLPLNAAPPSSVPPVPPSEALPPPACPSA    281 - 350
PAPRRSIISRLFGTSPATEAAPPPPEPVPAAEGPATVQSVEDFVPDDRLDRSFLEDTTPARDEKKVGAKA    351 - 420
AQQDSDSDGEALGGNPMVAGFQDDVDLEDQPRGSPPLPAGPVPSQDITLSSEEEAEVAAPTKGPAPAPQQ    421 - 490
CSEPETKWSSIPASKPRRGTAPTRTAAPPWPGGVSVRTGPEKRSSTRPPAEMEPGKGEQASSSESDPEGP    491 - 560
IAAQMLSFVMDDPDFESEGSDTQRRADDFPVRDDPSDVTDEDEGPAEPPPPPKLPLPAFRLKNDSDLFGL    561 - 630
GLEEAGPKESSEEGKEGKTPSKEKKKKKKKGKEEEEKAAKKKSKHKKSKDKEEGKEERRRRQQRPPRSRE    631 - 700
RTAADELEAFLGGGAPGGRHPGGGDYEEL                                             701 - 729
//

Text Mined References (28)

PMID Year Title