Property Summary

NCBI Gene PubMed Count 14
PubMed Score 30.68
PubTator Score 11.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.700 1.5e-04
astrocytic glioma -1.400 3.7e-02
atypical teratoid / rhabdoid tumor -2.500 3.7e-10
Breast cancer -1.200 4.9e-13
ependymoma -1.200 3.7e-02
glioblastoma -1.300 7.9e-06
group 4 medulloblastoma -1.900 8.7e-05
medulloblastoma, large-cell -2.900 1.2e-05
non-small cell lung cancer -1.052 2.2e-19
osteosarcoma 2.018 9.2e-04
ovarian cancer -1.800 2.9e-10
Pick disease -1.300 1.9e-07
primitive neuroectodermal tumor -1.500 1.7e-03
progressive supranuclear palsy -1.100 2.3e-02

Gene RIF (5)

AA Sequence

MSLLDGLASSPRAPLQSSKARMKKLPKKSQNEKYRLKYLRLRKAAKATVFENAAICDEIARLEEKFLKAK      1 - 70
EERRYLLKKLLQLQALTEGEVQAAAPSHSSSLPLTYGVASSVGTIQGAGPISGPSTGAEEPFGKKTKKEK     71 - 140
KEKGKENNKLEVLKKTCKKKKMAGGARKLVQPIALDPSGRPVFPIGLGGLTVYSLGEIITDRPGFHDESA    141 - 210
IYPVGYCSTRIYASMKCPDQKCLYTCQIKDGGVQPQFEIVPEDDPQNAIVSSSADACHAELLRTISTTMG    211 - 280
KLMPNLLPAGADFFGFSHPAIHNLIQSCPGARKCINYQWVKFDVCKPGDGQLPEGLPENDAAMSFEAFQR    281 - 350
QIFDEDQNDPLLPGSLDLPELQPAAFVSSYQPMYLTHEPLVDTHLQHLKSPSQGSPIQSSD             351 - 411
//

Text Mined References (17)

PMID Year Title