Property Summary

NCBI Gene PubMed Count 13
Grant Count 12
R01 Count 9
Funding $932,380.49
PubMed Score 27.35
PubTator Score 11.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.400 0.037
posterior fossa group A ependymoma -1.500 0.000
osteosarcoma 2.018 0.001
glioblastoma -2.300 0.000
medulloblastoma -2.100 0.000
atypical teratoid / rhabdoid tumor -2.500 0.000
medulloblastoma, large-cell -2.900 0.000
primitive neuroectodermal tumor -1.500 0.002
non-small cell lung cancer -1.052 0.000
pediatric high grade glioma -1.800 0.000
Pick disease -1.400 0.000
progressive supranuclear palsy -1.100 0.023
Breast cancer -1.300 0.000
ovarian cancer -1.800 0.000

Gene RIF (4)

PMID Text
24621507 NIAM regulates 2 critical pathways that control p53 function and are altered in human cancers, implying an important role for NIAM in tumorigenesis.
20506279 Sructure of a fragment of TBRG1 was shown to encompasses two motifs. The FYRN and FYRC regions each form part of a single folded module (the FYR domain), which adopts a novel alpha + beta fold.
18582208 NIAM is a nuclear interactor of ARF and Mdm2
17110379 novel protein with tumor suppressor-like behaviors and functional links to ARF-MDM2-p53 signaling

AA Sequence

MSLLDGLASSPRAPLQSSKARMKKLPKKSQNEKYRLKYLRLRKAAKATVFENAAICDEIARLEEKFLKAK      1 - 70
EERRYLLKKLLQLQALTEGEVQAAAPSHSSSLPLTYGVASSVGTIQGAGPISGPSTGAEEPFGKKTKKEK     71 - 140
KEKGKENNKLEVLKKTCKKKKMAGGARKLVQPIALDPSGRPVFPIGLGGLTVYSLGEIITDRPGFHDESA    141 - 210
IYPVGYCSTRIYASMKCPDQKCLYTCQIKDGGVQPQFEIVPEDDPQNAIVSSSADACHAELLRTISTTMG    211 - 280
KLMPNLLPAGADFFGFSHPAIHNLIQSCPGARKCINYQWVKFDVCKPGDGQLPEGLPENDAAMSFEAFQR    281 - 350
QIFDEDQNDPLLPGSLDLPELQPAAFVSSYQPMYLTHEPLVDTHLQHLKSPSQGSPIQSSD             351 - 411
//

Text Mined References (16)

PMID Year Title
24621507 2014 Nuclear interactor of ARF and Mdm2 regulates multiple pathways to activate p53.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20506279 2010 The structure of the FYR domain of transforming growth factor beta regulator 1.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18582208 2008 Generation and characterization of monoclonal antibodies to NIAM: a nuclear interactor of ARF and Mdm2.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17110379 2007 A novel nuclear interactor of ARF and MDM2 (NIAM) that maintains chromosomal stability.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16582619 2006 Identification of novel ARF binding proteins by two-hybrid screening.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...