Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 1.30689705219808E-11
osteosarcoma 7933 6.74158052048244E-9
medulloblastoma, large-cell 6234 2.15513156466982E-4
adult high grade glioma 2148 0.00441576457648495
atypical teratoid / rhabdoid tumor 4369 0.0126769518903738
Disease Target Count Z-score Confidence
Seminoma 15 4.28 2.1

Synonym

Accession Q3Y452
Symbols

Gene

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MKRREAVCAHRHFLGTGKPPHPLGRSIPVEPCPGLPAFAEVDLLSLLVPIKISSTPPSGSRLDPQIASSA      1 - 70
FPGLGSLGGQDSSGSLVQRASCELESPYEL                                             71 - 100
//

Text Mined References (2)

PMID Year Title
22123530 2011 Characterization of a novel human testis-specific gene: testis developmental related gene 1 (TDRG1).
14574404 2003 The DNA sequence and analysis of human chromosome 6.