Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Seminoma 15 4.029 2.0

AA Sequence

MKRREAVCAHRHFLGTGKPPHPLGRSIPVEPCPGLPAFAEVDLLSLLVPIKISSTPPSGSRLDPQIASSA      1 - 70
FPGLGSLGGQDSSGSLVQRASCELESPYEL                                             71 - 100
//

Text Mined References (2)

PMID Year Title