Property Summary

NCBI Gene PubMed Count 60
Grant Count 2
R01 Count 1
Funding $336,926
PubMed Score 75.06
PubTator Score 61.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
chronic lymphosyte leukemia 3.600 0.000
psoriasis -3.200 0.000

Synonym

Accession Q3V6T2 A1IGE7 B7ZM78 C9JG83 Q53SF1 Q581G3 Q5HYD0 Q7Z339 Q7Z3C5
Symbols APE
GIV
GRDN
PEHO
HkRP1
GIRDIN
KIAA1212

Gene

 Grant Application (2)

Gene RIF (52)

PMID Text
26917597 CCDC88A is essential for multiple aspects of normal development and loss of CCDC88A is a cause of the PEHO syndrome phenotype.
26887938 Phosphorylation of GIV at Tyr-1764/Tyr-1798 is also required to enhance PI3K-Akt signaling and tumor cell migration in response to integrin stimulation, indicating that GIV functions in Tyr(P)-dependent integrin signaling.
26743900 miR-101 inhibits cell proliferation, migration and invasion in hepatocellular carcinoma through downregulating Girdin.
26514725 GIV directly and constitutively binds the exocyst complex subunit Exo-70 and also associates with GLUT4-storage vesicles (GSVs) exclusively upon insulin stimulation.
26391662 GIV and its substrate Galphai3 are recruited to active integrin complexes
26378251 GIV is an essential upstream component that couples InsR to G-protein signaling to enhance the metabolic insulin response, and impairment of such coupling triggers IR.
26163263 findings suggest that the STAT3/Girdin/Akt pathway activates in osteoblasts in response to mechanical stimulation and may play a significant role in triggering osteoblast proliferation and migration during orthodontic treatment
26151295 Girdin regulates the migration and invasion of glioma cells via the PI3K-Akt signaling pathway.
25977476 transcriptional upregulation of Girdin expression and Girdin-Galphai3 signaling play crucial roles in regulating epithelial apicobasal polarity through the PAR complex.
25926659 TAT-GIV peptides provide a novel and versatile tool to manipulate Galphai activation downstream of growth factors in a diverse array of pathophysiologic conditions.
More...

AA Sequence

MENEIFTPLLEQFMTSPLVTWVKTFGPLAAGNGTNLDEYVALVDGVFLNQVMLQINPKLESQRVNKKVNN      1 - 70
DASLRMHNLSILVRQIKFYYQETLQQLIMMSLPNVLIIGKNPFSEQGTEEVKKLLLLLLGCAVQCQKKEE     71 - 140
FIERIQGLDFDTKAAVAAHIQEVTHNQENVFDLQWMEVTDMSQEDIEPLLKNMALHLKRLIDERDEHSET    141 - 210
IIELSEERDGLHFLPHASSSAQSPCGSPGMKRTESRQHLSVELADAKAKIRRLRQELEEKTEQLLDCKQE    211 - 280
LEQMEIELKRLQQENMNLLSDARSARMYRDELDALREKAVRVDKLESEVSRYKERLHDIEFYKARVEELK    281 - 350
EDNQVLLETKTMLEDQLEGTRARSDKLHELEKENLQLKAKLHDMEMERDMDRKKIEELMEENMTLEMAQK    351 - 420
QSMDESLHLGWELEQISRTSELSEAPQKSLGHEVNELTSSRLLKLEMENQSLTKTVEELRTTVDSVEGNA    421 - 490
SKILKMEKENQRLSKKVEILENEIVQEKQSLQNCQNLSKDLMKEKAQLEKTIETLRENSERQIKILEQEN    491 - 560
EHLNQTVSSLRQRSQISAEARVKDIEKENKILHESIKETSSKLSKIEFEKRQIKKELEHYKEKGERAEEL    561 - 630
ENELHHLEKENELLQKKITNLKITCEKIEALEQENSELERENRKLKKTLDSFKNLTFQLESLEKENSQLD    631 - 700
EENLELRRNVESLKCASMKMAQLQLENKELESEKEQLKKGLELLKASFKKTERLEVSYQGLDIENQRLQK    701 - 770
TLENSNKKIQQLESELQDLEMENQTLQKNLEELKISSKRLEQLEKENKSLEQETSQLEKDKKQLEKENKR    771 - 840
LRQQAEIKDTTLEENNVKIGNLEKENKTLSKEIGIYKESCVRLKELEKENKELVKRATIDIKTLVTLRED    841 - 910
LVSEKLKTQQMNNDLEKLTHELEKIGLNKERLLHDEQSTDDSRYKLLESKLESTLKKSLEIKEEKIAALE    911 - 980
ARLEESTNYNQQLRQELKTVKKNYEALKQRQDEERMVQSSPPISGEDNKWERESQETTRELLKVKDRLIE    981 - 1050
VERNNATLQAEKQALKTQLKQLETQNNNLQAQILALQRQTVSLQEQNTTLQTQNAKLQVENSTLNSQSTS   1051 - 1120
LMNQNAQLLIQQSSLENENESVIKEREDLKSLYDSLIKDHEKLELLHERQASEYESLISKHGTLKSAHKN   1121 - 1190
LEVEHRDLEDRYNQLLKQKGQLEDLEKMLKVEQEKMLLENKNHETVAAEYKKLCGENDRLNHTYSQLLKE   1191 - 1260
TEVLQTDHKNLKSLLNNSKLEQTRLEAEFSKLKEQYQQLDITSTKLNNQCELLSQLKGNLEEENRHLLDQ   1261 - 1330
IQTLMLQNRTLLEQNMESKDLFHVEQRQYIDKLNELRRQKEKLEEKIMDQYKFYDPSPPRRRGNWITLKM   1331 - 1400
RKLIKSKKDINRERQKSLTLTPTRSDSSEGFLQLPHQDSQDSSSVGSNSLEDGQTLGTKKSSMVALKRLP   1401 - 1470
FLRNRPKDKDKMKACYRRSMSMNDLVQSMVLAGQWTGSTENLEVPDDISTGKRRKELGAMAFSTTAINFS   1471 - 1540
TVNSSAGFRSKQLVNNKDTTSFEDISPQGVSDDSSTGSRVHASRPASLDSGRTSTSNSNNNASLHEVKAG   1541 - 1610
AVNNQSRPQSHSSGEFSLLHDHEAWSSSGSSPIQYLKRQTRSSPVLQHKISETLESRHHKIKTGSPGSEV   1611 - 1680
VTLQQFLEESNKLTSVQIKSSSQENLLDEVMKSLSVSSDFLGKDKPVSCGLARSVSGKTPGDFYDRRTTK   1681 - 1750
PEFLRPGPRKTEDTYFISSAGKPTPGTQGKIKLVKESSLSRQSKDSNPYATLPRASSVISTAEGTTRRTS   1751 - 1820
IHDFLTKDSRLPISVDSPPAAADSNTTAASNVDKVQESRNSKSRSREQQSS                      1821 - 1871
//

Text Mined References (71)

PMID Year Title
27623382 2016 A Conserved Role for Girdin in Basal Body Positioning and Ciliogenesis.
26917597 2016 CCDC88A mutations cause PEHO-like syndrome in humans and mouse.
26887938 2016 GIV/Girdin (G?-interacting, Vesicle-associated Protein/Girdin) Creates a Positive Feedback Loop That Potentiates Outside-in Integrin Signaling in Cancer Cells.
26743900 2016 miR-101 Inhibiting Cell Proliferation, Migration and Invasion in Hepatocellular Carcinoma through Downregulating Girdin.
26514725 2015 GIV/girdin binds exocyst subunit-Exo70 and regulates exocytosis of GLUT4 storage vesicles.
26391662 2015 Integrins activate trimeric G proteins via the nonreceptor protein GIV/Girdin.
26378251 2015 Activation of G proteins by GIV-GEF is a pivot point for insulin resistance and sensitivity.
26163263 2015 Girdin/GIV is upregulated by cyclic tension, propagates mechanical signal transduction, and is required for the cellular proliferation and migration of MG-63 cells.
26151295 2015 Girdin regulates the migration and invasion of glioma cells via the PI3K-Akt signaling pathway.
25977476 2015 Regulation of epithelial cell polarity by PAR-3 depends on Girdin transcription and Girdin-G?i3 signaling.
More...