Property Summary

NCBI Gene PubMed Count 18
Grant Count 5
R01 Count 5
Funding $452,978
PubMed Score 12.25
PubTator Score 20.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
posterior fossa group A ependymoma -1.300 0.000
glioblastoma -1.700 0.000
atypical teratoid / rhabdoid tumor -1.500 0.000
medulloblastoma, large-cell -1.800 0.000
adult high grade glioma -1.900 0.000
pilocytic astrocytoma -1.700 0.000
ovarian cancer 1.400 0.000

Gene RIF (23)

PMID Text
23960081 ENPP3 is a regulator of N-acetylglucosaminyltransferase GnT-IX (GnT-Vb)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19846580 The activity of GnT-Vb was stimulated over 4-fold in the presence of 10 mM Mn(++), and pH optimum for GnT-Vb was 8.0.
18838383 GnT-Vb-mediated glycosylation of RPTPbeta promotes galectin-1 binding and RPTPbeta levels of retention on the cell surface.
16857188 GnT-Vb enzyme involved in the O-mannosyl glycosylation pathway, play an active role in modulating integrin and laminin-dependent adhesion and migration of human neuronal cells.
16606368 These results demonstrate that GnT-VB expression can modulate the rate of neurite outgrowth by affecting beta1 integrin-ECM interaction.
16413118 following human GnT-IX and GnT-V transfection in COS cells, antibody specifically recognized GnT-IX, but not GnT-V, in the Golgi apparatus
14561752 N-linked beta(1,6) branching has a role in cell-cell adhesion, cellular motility and neoplasm invasiveness
More...

AA Sequence

MITVNPDGKIMVRRCLVTLRPFRLFVLGIGFFTLCFLMTSLGGQFSARRLGDSPFTIRTEVMGGPESRGV      1 - 70
LRKMSDLLELMVKRMDALARLENSSELHRAGGDLHFPADRMPPGAGLMERIQAIAQNVSDIAVKVDQILR     71 - 140
HSLLLHSKVSEGRRDQCEAPSDPKFPDCSGKVEWMRARWTSDPCYAFFGVDGTECSFLIYLSEVEWFCPP    141 - 210
LPWRNQTAAQRAPKPLPKVQAVFRSNLSHLLDLMGSGKESLIFMKKRTKRLTAQWALAAQRLAQKLGATQ    211 - 280
RDQKQILVHIGFLTEESGDVFSPRVLKGGPLGEMVQWADILTALYVLGHGLRVTVSLKELQSNLGVPPGR    281 - 350
GSCPLTMPLPFDLIYTDYHGLQQMKRHMGLSFKKYRCRIRVIDTFGTEPAYNHEEYATLHGYRTNWGYWN    351 - 420
LNPKQFMTMFPHTPDNSFMGFVSEELNETEKRLIKGGKASNMAVVYGKEASIWKLQGKEKFLGILNKYME    421 - 490
IHGTVYYESQRPPEVPAFVKNHGLLPQPEFQQLLRKAKLFIGFGFPYEGPAPLEAIANGCIFLQSRFSPP    491 - 560
HSSLNHEFFRGKPTSREVFSQHPYAENFIGKPHVWTVDYNNSEEFEAAIKAIMRTQVDPYLPYEYTCEGM    561 - 630
LERIHAYIQHQDFCRAPDPALPEAHAPQSPFVLAPNATHLEWARNTSLAPGAWPPAHALRAWLAVPGRAC    631 - 700
TDTCLDHGLICEPSFFPFLNSQDAFLKLQVPCDSTESEMNHLYPAFAQPGQECYLQKEPLLFSCAGSNTK    701 - 770
YRRLCPCRDFRKGQVALCQGCL                                                    771 - 792
//

Text Mined References (21)

PMID Year Title
24383474 2014 Genome-wide study of percent emphysema on computed tomography in the general population. The Multi-Ethnic Study of Atherosclerosis Lung/SNP Health Association Resource Study.
23960081 2013 Identification of ectonucleotide pyrophosphatase/phosphodiesterase 3 (ENPP3) as a regulator of N-acetylglucosaminyltransferase GnT-IX (GnT-Vb).
23088713 2012 Protein interactions of the transcription factor Hoxa1.
22823124 2013 The genetic aetiology of cannabis use initiation: a meta-analysis of genome-wide association studies and a SNP-based heritability estimation.
22683750 2012 A meta-analysis of genome-wide association studies of the electrocardiographic early repolarization pattern.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19846580 2010 Comparison of the substrate specificities and catalytic properties of the sister N-acetylglucosaminyltransferases, GnT-V and GnT-Vb (IX).
18838383 2008 Receptor tyrosine phosphatase beta (RPTPbeta) activity and signaling are attenuated by glycosylation and subsequent cell surface galectin-1 binding.
More...