Property Summary

NCBI Gene PubMed Count 19
PubMed Score 12.76
PubTator Score 20.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.900 6.6e-06
Astrocytoma, Pilocytic -1.600 1.8e-06
atypical teratoid / rhabdoid tumor -1.500 6.2e-06
ependymoma -1.200 2.3e-07
glioblastoma -1.100 1.4e-05
medulloblastoma, large-cell -1.800 1.5e-04
ovarian cancer 1.400 2.2e-12

Gene RIF (23)

AA Sequence

MITVNPDGKIMVRRCLVTLRPFRLFVLGIGFFTLCFLMTSLGGQFSARRLGDSPFTIRTEVMGGPESRGV      1 - 70
LRKMSDLLELMVKRMDALARLENSSELHRAGGDLHFPADRMPPGAGLMERIQAIAQNVSDIAVKVDQILR     71 - 140
HSLLLHSKVSEGRRDQCEAPSDPKFPDCSGKVEWMRARWTSDPCYAFFGVDGTECSFLIYLSEVEWFCPP    141 - 210
LPWRNQTAAQRAPKPLPKVQAVFRSNLSHLLDLMGSGKESLIFMKKRTKRLTAQWALAAQRLAQKLGATQ    211 - 280
RDQKQILVHIGFLTEESGDVFSPRVLKGGPLGEMVQWADILTALYVLGHGLRVTVSLKELQSNLGVPPGR    281 - 350
GSCPLTMPLPFDLIYTDYHGLQQMKRHMGLSFKKYRCRIRVIDTFGTEPAYNHEEYATLHGYRTNWGYWN    351 - 420
LNPKQFMTMFPHTPDNSFMGFVSEELNETEKRLIKGGKASNMAVVYGKEASIWKLQGKEKFLGILNKYME    421 - 490
IHGTVYYESQRPPEVPAFVKNHGLLPQPEFQQLLRKAKLFIGFGFPYEGPAPLEAIANGCIFLQSRFSPP    491 - 560
HSSLNHEFFRGKPTSREVFSQHPYAENFIGKPHVWTVDYNNSEEFEAAIKAIMRTQVDPYLPYEYTCEGM    561 - 630
LERIHAYIQHQDFCRAPDPALPEAHAPQSPFVLAPNATHLEWARNTSLAPGAWPPAHALRAWLAVPGRAC    631 - 700
TDTCLDHGLICEPSFFPFLNSQDAFLKLQVPCDSTESEMNHLYPAFAQPGQECYLQKEPLLFSCAGSNTK    701 - 770
YRRLCPCRDFRKGQVALCQGCL                                                    771 - 792
//

Text Mined References (22)

PMID Year Title