Property Summary

NCBI Gene PubMed Count 18
Grant Count 5
R01 Count 5
Funding $235,985.42
PubMed Score 59.01
PubTator Score 13.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.532 0.033
ulcerative colitis -1.700 0.000
psoriasis -2.800 0.000

Synonym

Accession Q3SYC2 A8K7I3 Q3SYC1 Q6ZQZ2 Q86UH6 Q9H630
Symbols hDC5
MGAT2
DGAT2L5
DGAT2L5.

Gene

PANTHER Protein Class (2)

Gene RIF (2)

PMID Text
23536640 MGAT2 in the intestine plays an indispensable role in enhancing metabolic efficiency but also raise the possibility that MGAT2 in other tissues may contribute to the regulation of energy metabolism.
12576479 MGAT2 may play an important role in dietary fat absorption

AA Sequence

MVEFAPLFMPWERRLQTLAVLQFVFSFLALAEICTVGFIALLFTRFWLLTVLYAAWWYLDRDKPRQGGRH      1 - 70
IQAIRCWTIWKYMKDYFPISLVKTAELDPSRNYIAGFHPHGVLAVGAFANLCTESTGFSSIFPGIRPHLM     71 - 140
MLTLWFRAPFFRDYIMSAGLVTSEKESAAHILNRKGGGNLLGIIVGGAQEALDARPGSFTLLLRNRKGFV    141 - 210
RLALTHGAPLVPIFSFGENDLFDQIPNSSGSWLRYIQNRLQKIMGISLPLFHGRGVFQYSFGLIPYRRPI    211 - 280
TTVVGKPIEVQKTLHPSEEEVNQLHQRYIKELCNLFEAHKLKFNIPADQHLEFC                    281 - 334
//

Text Mined References (18)

PMID Year Title
25598079 2015 Cell-based assay of MGAT2-driven diacylglycerol synthesis for profiling inhibitors: use of a stable isotope-labeled substrate and high-resolution LC/MS.
25164810 2014 Diacylglycerol acyltransferase-2 (DGAT2) and monoacylglycerol acyltransferase-2 (MGAT2) interact to promote triacylglycerol synthesis.
24823311 2014 Genome-wide association study of plasma N6 polyunsaturated fatty acids within the cohorts for heart and aging research in genomic epidemiology consortium.
24573674 2014 Monoacylglycerol acyltransferase-2 is a tetrameric enzyme that selectively heterodimerizes with diacylglycerol acyltransferase-1.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23541669 2013 Identification and design of a novel series of MGAT2 inhibitors.
23536640 2013 Intestine-specific expression of MOGAT2 partially restores metabolic efficiency in Mogat2-deficient mice.
23241455 2012 Regulation of lipid metabolism-related gene expression in whole blood cells of normo- and dyslipidemic men after fish oil supplementation.
22394502 2012 Evidence for regulated monoacylglycerol acyltransferase expression and activity in human liver.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...