Property Summary

Ligand Count 176
NCBI Gene PubMed Count 18
PubMed Score 13.35
PubTator Score 13.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 1.8e-30
ulcerative colitis 1819 5.6e-05
pancreatic ductal adenocarcinoma liver metastasis 1962 3.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Obesity 678 3.262 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.532 3.3e-02
psoriasis -2.800 1.8e-30
ulcerative colitis -1.700 5.6e-05

Gene RIF (2)

AA Sequence

MVEFAPLFMPWERRLQTLAVLQFVFSFLALAEICTVGFIALLFTRFWLLTVLYAAWWYLDRDKPRQGGRH      1 - 70
IQAIRCWTIWKYMKDYFPISLVKTAELDPSRNYIAGFHPHGVLAVGAFANLCTESTGFSSIFPGIRPHLM     71 - 140
MLTLWFRAPFFRDYIMSAGLVTSEKESAAHILNRKGGGNLLGIIVGGAQEALDARPGSFTLLLRNRKGFV    141 - 210
RLALTHGAPLVPIFSFGENDLFDQIPNSSGSWLRYIQNRLQKIMGISLPLFHGRGVFQYSFGLIPYRRPI    211 - 280
TTVVGKPIEVQKTLHPSEEEVNQLHQRYIKELCNLFEAHKLKFNIPADQHLEFC                    281 - 334
//

Text Mined References (18)

PMID Year Title