Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q3SYA9
Symbols POM121L1

Gene

 Compartment GO Term (1)

AA Sequence

MDSLWGPGAGSHPFGVHNSRLSPDLCPGKIVLRALKESGAGMPEQDKDPRVQENPGDQRRVPEVTGDAPS      1 - 70
AFRPLRDNGGLSPFVPGPGPLQTDLHAQRSEIRYNQTSQTSWTSSCTNRNAISSSYSSTGGLPGLKRRRG     71 - 140
PASSHCQLTLSSSKTVSEDRPQAVSSGHTQCEKVAEIAPGQTLALRNDSSRSEASRPSTRKFPLLPRRRG    141 - 210
EPLMLPPPVELGYRVTAEDLDWEKEAAFQCIKSALQVEDKAISDCRPSRPSHTLSSLATGASGLPAVSKA    211 - 280
PSMDAQQERHKSQDCLGLVAPLASATEVPSTAPMSGEKHRPPGPLFSSSDPLPATSSHSQDSAQVTSLIP    281 - 350
APFPAASMDAGMRRTRPGTSAPAAAAAAPPPSTLNRTLGSLLEWMEALHISGPQPQLQQVPRGQNQRSQT    351 - 420
SRTSSCPK                                                                  421 - 428
//

Text Mined References (5)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.
9391893 1997 Radial aplasia and chromosome 22q11 deletion.
9074928 1997 One-megabase sequence analysis of the human immunoglobulin lambda gene locus.