Property Summary

NCBI Gene PubMed Count 11
Grant Count 11
R01 Count 11
Funding $1,145,014.34
PubMed Score 7.94
PubTator Score 4.53

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

PMID Text
22082156 Knockdown of aldehyde dehydrogenase 1 family, member L2 (ALDH1L2) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
21238436 ALDH1L2 has enzymatic properties similar to its cytosolic counterpart
20877624 Observational study of gene-disease association. (HuGE Navigator)
20498374 a gene at chromosome locus 12q24.11 of the human genome, the product of which has 74% sequence similarity with cytosolic FDH
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19933275 Our study identifies human PPT as the FDH-modifying enzyme and supports the hypothesis that mammals utilize a single enzyme for all phosphopantetheinylation reactions.

AA Sequence

MLRRGSQALRRFSTGRVYFKNKLKLALIGQSLFGQEVYSHLRKEGHRVVGVFTVPDKDGKADPLALAAEK      1 - 70
DGTPVFKLPKWRVKGKTIKEVAEAYRSVGAELNVLPFCTQFIPMDIIDSPKHGSIIYHPSILPRHRGASA     71 - 140
INWTLIMGDKKAGFSVFWADDGLDTGPILLQRSCDVEPNDTVDALYNRFLFPEGIKAMVEAVQLIADGKA    141 - 210
PRIPQPEEGATYEGIQKKENAEISWDQSAEVLHNWIRGHDKVPGAWTEINGQMVTFYGSTLLNSSVPPGE    211 - 280
PLEIKGAKKPGLVTKNGLVLFGNDGKALTVRNLQFEDGKMIPASQYFSTGETSVVELTAEEVKVAETIKV    281 - 350
IWAGILSNVPIIEDSTDFFKSGASSMDVARLVEEIRQKCGGLQLQNEDVYMATKFEGFIQKVVRKLRGED    351 - 420
QEVELVVDYISKEVNEIMVKMPYQCFINGQFTDADDGKTYDTINPTDGSTICKVSYASLADVDKAVAAAK    421 - 490
DAFENGEWGRMNARERGRLMYRLADLLEENQEELATIEALDSGAVYTLALKTHIGMSVQTFRYFAGWCDK    491 - 560
IQGSTIPINQARPNRNLTFTKKEPLGVCAIIIPWNYPLMMLAWKSAACLAAGNTLVLKPAQVTPLTALKF    561 - 630
AELSVKAGFPKGVINIIPGSGGIAGQRLSEHPDIRKLGFTGSTPIGKQIMKSCAVSNLKKVSLELGGKSP    631 - 700
LIIFNDCELDKAVRMGMGAVFFNKGENCIAAGRLFVEESIHDEFVTRVVEEIKKMKIGDPLDRSTDHGPQ    701 - 770
NHKAHLEKLLQYCETGVKEGATLVYGGRQVQRPGFFMEPTVFTDVEDYMYLAKEESFGPIMVISKFQNGD    771 - 840
IDGVLQRANSTEYGLASGVFTRDINKAMYVSEKLEAGTVFINTYNKTDVAAPFGGVKQSGFGKDLGEEAL    841 - 910
NEYLKTKTVTLEY                                                             911 - 923
//

Text Mined References (15)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
21789175 2011 Identification and analysis of intermediate size noncoding RNAs in the human fetal brain.
21238436 2011 Enzymatic properties of ALDH1L2, a mitochondrial 10-formyltetrahydrofolate dehydrogenase.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20498374 2010 ALDH1L2 is the mitochondrial homolog of 10-formyltetrahydrofolate dehydrogenase.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19933275 2010 Acyl carrier protein-specific 4'-phosphopantetheinyl transferase activates 10-formyltetrahydrofolate dehydrogenase.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
More...