Property Summary

NCBI Gene PubMed Count 11
PubMed Score 7.94
PubTator Score 4.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 7.33842886127044E-12
pilocytic astrocytoma 3086 8.08362311453579E-7
pituitary cancer 1972 5.05968561553986E-6
intraductal papillary-mucinous adenoma (IPMA) 2956 8.74607053944203E-6
interstitial cystitis 2299 3.90644828535518E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 4.07547125735358E-5
glioblastoma 5572 2.64219282244301E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 3.7384144936339E-4
pediatric high grade glioma 2712 4.94692363041541E-4
ovarian cancer 8492 9.18235907186796E-4
pancreatic cancer 2300 0.00130666376862634
sonic hedgehog group medulloblastoma 1482 0.00316578249731428
osteosarcoma 7933 0.00449471226020764
primary pancreatic ductal adenocarcinoma 1271 0.00977081280824247
oligodendroglioma 2849 0.0410806731781369
pancreatic carcinoma 567 0.0496694810351633

Expression

Synonym

Gene

PANTHER Protein Class (2)

  Ortholog (12)

 GWAS Trait (1)

Gene RIF (6)

PMID Text
22082156 Knockdown of aldehyde dehydrogenase 1 family, member L2 (ALDH1L2) by siRNA enhances the early stages of HIV-1 replication in HeLa-CD4 cells infected with viral pseudotypes HIV89.6R and HIV8.2N
21238436 ALDH1L2 has enzymatic properties similar to its cytosolic counterpart
20877624 Observational study of gene-disease association. (HuGE Navigator)
20498374 a gene at chromosome locus 12q24.11 of the human genome, the product of which has 74% sequence similarity with cytosolic FDH
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19933275 Our study identifies human PPT as the FDH-modifying enzyme and supports the hypothesis that mammals utilize a single enzyme for all phosphopantetheinylation reactions.

AA Sequence

MLRRGSQALRRFSTGRVYFKNKLKLALIGQSLFGQEVYSHLRKEGHRVVGVFTVPDKDGKADPLALAAEK      1 - 70
DGTPVFKLPKWRVKGKTIKEVAEAYRSVGAELNVLPFCTQFIPMDIIDSPKHGSIIYHPSILPRHRGASA     71 - 140
INWTLIMGDKKAGFSVFWADDGLDTGPILLQRSCDVEPNDTVDALYNRFLFPEGIKAMVEAVQLIADGKA    141 - 210
PRIPQPEEGATYEGIQKKENAEISWDQSAEVLHNWIRGHDKVPGAWTEINGQMVTFYGSTLLNSSVPPGE    211 - 280
PLEIKGAKKPGLVTKNGLVLFGNDGKALTVRNLQFEDGKMIPASQYFSTGETSVVELTAEEVKVAETIKV    281 - 350
IWAGILSNVPIIEDSTDFFKSGASSMDVARLVEEIRQKCGGLQLQNEDVYMATKFEGFIQKVVRKLRGED    351 - 420
QEVELVVDYISKEVNEIMVKMPYQCFINGQFTDADDGKTYDTINPTDGSTICKVSYASLADVDKAVAAAK    421 - 490
DAFENGEWGRMNARERGRLMYRLADLLEENQEELATIEALDSGAVYTLALKTHIGMSVQTFRYFAGWCDK    491 - 560
IQGSTIPINQARPNRNLTFTKKEPLGVCAIIIPWNYPLMMLAWKSAACLAAGNTLVLKPAQVTPLTALKF    561 - 630
AELSVKAGFPKGVINIIPGSGGIAGQRLSEHPDIRKLGFTGSTPIGKQIMKSCAVSNLKKVSLELGGKSP    631 - 700
LIIFNDCELDKAVRMGMGAVFFNKGENCIAAGRLFVEESIHDEFVTRVVEEIKKMKIGDPLDRSTDHGPQ    701 - 770
NHKAHLEKLLQYCETGVKEGATLVYGGRQVQRPGFFMEPTVFTDVEDYMYLAKEESFGPIMVISKFQNGD    771 - 840
IDGVLQRANSTEYGLASGVFTRDINKAMYVSEKLEAGTVFINTYNKTDVAAPFGGVKQSGFGKDLGEEAL    841 - 910
NEYLKTKTVTLEY                                                             911 - 923
//

Text Mined References (15)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
21789175 2011 Identification and analysis of intermediate size noncoding RNAs in the human fetal brain.
21238436 2011 Enzymatic properties of ALDH1L2, a mitochondrial 10-formyltetrahydrofolate dehydrogenase.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20498374 2010 ALDH1L2 is the mitochondrial homolog of 10-formyltetrahydrofolate dehydrogenase.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19933275 2010 Acyl carrier protein-specific 4'-phosphopantetheinyl transferase activates 10-formyltetrahydrofolate dehydrogenase.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
More...