Property Summary

NCBI Gene PubMed Count 6
PubMed Score 302.52
PubTator Score 359.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Alzheimer's disease 644
Disease Target Count P-value
interstitial cystitis 2299 1.35285036265842E-4
osteosarcoma 7933 0.00124476294406531

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.463 0.001
interstitial cystitis -1.100 0.000

Synonym

Accession Q3SY56 B3KXS4
Symbols EPFN
KLF14
EPIPROFIN

Gene

SP6

  Ortholog (11)

Gene RIF (1)

PMID Text
25344255 epiprofin (Epfn, also known as Sp6) plays crucial distinct roles in these transition stages as a cell cycle regulator and a transcription factor.

AA Sequence

MLTAVCGSLGSQHTEAPHASPPRLDLQPLQTYQGHTSPEAGDYPSPLQPGELQSLPLGPEVDFSQGYELP      1 - 70
GASSRVTCEDLESDSPLAPGPFSKLLQPDMSHHYESWFRPTHPGAEDGSWWDLHPGTSWMDLPHTQGALT     71 - 140
SPGHPGALQAGLGGYVGDHQLCAPPPHPHAHHLLPAAGGQHLLGPPDGAKALEVAAPESQGLDSSLDGAA    141 - 210
RPKGSRRSVPRSSGQTVCRCPNCLEAERLGAPCGPDGGKKKHLHNCHIPGCGKAYAKTSHLKAHLRWHSG    211 - 280
DRPFVCNWLFCGKRFTRSDELQRHLQTHTGTKKFPCAVCSRVFMRSDHLAKHMKTHEGAKEEAAGAASGE    281 - 350
GKAGGAVEPPGGKGKREAEGSVAPSN                                                351 - 376
//

Text Mined References (7)

PMID Year Title
25344255 2014 Epiprofin orchestrates epidermal keratinocyte proliferation and differentiation.
23535033 2014 Genome-wide association study of the rate of cognitive decline in Alzheimer's disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14551215 2004 The Krüppel-like factor epiprofin is expressed by epithelium of developing teeth, hair follicles, and limb buds and promotes cell proliferation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11087666 2000 Identification of KLF13 and KLF14 (SP6), novel members of the SP/XKLF transcription factor family.