Property Summary

NCBI Gene PubMed Count 6
PubMed Score 339.58
PubTator Score 359.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
interstitial cystitis -1.100 1.4e-04
osteosarcoma 1.463 1.2e-03

Protein-protein Interaction (7)

Gene RIF (1)

AA Sequence

MLTAVCGSLGSQHTEAPHASPPRLDLQPLQTYQGHTSPEAGDYPSPLQPGELQSLPLGPEVDFSQGYELP      1 - 70
GASSRVTCEDLESDSPLAPGPFSKLLQPDMSHHYESWFRPTHPGAEDGSWWDLHPGTSWMDLPHTQGALT     71 - 140
SPGHPGALQAGLGGYVGDHQLCAPPPHPHAHHLLPAAGGQHLLGPPDGAKALEVAAPESQGLDSSLDGAA    141 - 210
RPKGSRRSVPRSSGQTVCRCPNCLEAERLGAPCGPDGGKKKHLHNCHIPGCGKAYAKTSHLKAHLRWHSG    211 - 280
DRPFVCNWLFCGKRFTRSDELQRHLQTHTGTKKFPCAVCSRVFMRSDHLAKHMKTHEGAKEEAAGAASGE    281 - 350
GKAGGAVEPPGGKGKREAEGSVAPSN                                                351 - 376
//

Text Mined References (7)

PMID Year Title