Property Summary

NCBI Gene PubMed Count 6
Grant Count 19
R01 Count 6
Funding $3,732,423.67
PubMed Score 302.52
PubTator Score 359.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.463 0.001
interstitial cystitis -1.100 0.000

Gene RIF (1)

PMID Text
25344255 epiprofin (Epfn, also known as Sp6) plays crucial distinct roles in these transition stages as a cell cycle regulator and a transcription factor.

AA Sequence

MLTAVCGSLGSQHTEAPHASPPRLDLQPLQTYQGHTSPEAGDYPSPLQPGELQSLPLGPEVDFSQGYELP      1 - 70
GASSRVTCEDLESDSPLAPGPFSKLLQPDMSHHYESWFRPTHPGAEDGSWWDLHPGTSWMDLPHTQGALT     71 - 140
SPGHPGALQAGLGGYVGDHQLCAPPPHPHAHHLLPAAGGQHLLGPPDGAKALEVAAPESQGLDSSLDGAA    141 - 210
RPKGSRRSVPRSSGQTVCRCPNCLEAERLGAPCGPDGGKKKHLHNCHIPGCGKAYAKTSHLKAHLRWHSG    211 - 280
DRPFVCNWLFCGKRFTRSDELQRHLQTHTGTKKFPCAVCSRVFMRSDHLAKHMKTHEGAKEEAAGAASGE    281 - 350
GKAGGAVEPPGGKGKREAEGSVAPSN                                                351 - 376
//

Text Mined References (7)

PMID Year Title
25344255 2014 Epiprofin orchestrates epidermal keratinocyte proliferation and differentiation.
23535033 2014 Genome-wide association study of the rate of cognitive decline in Alzheimer's disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14551215 2004 The Krüppel-like factor epiprofin is expressed by epithelium of developing teeth, hair follicles, and limb buds and promotes cell proliferation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11087666 2000 Identification of KLF13 and KLF14 (SP6), novel members of the SP/XKLF transcription factor family.