Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.70
PubTator Score 1.07

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 6.2e-07
glioblastoma 1.200 8.0e-05
group 4 medulloblastoma 2.200 1.3e-06
medulloblastoma, large-cell 1.400 1.6e-04
primitive neuroectodermal tumor 1.100 2.5e-04
psoriasis -1.300 4.8e-79

AA Sequence

MAAAALRAPTQVTVSPETHMDLTKGCVTFEDIAIYFSQDEWGLLDEAQRLLYLEVMLENFALVASLGCGH      1 - 70
GTEDEETPSDQNVSVGVSQSKAGSSTQKTQSCEMCVPVLKDILHLADLPGQKPYLVGECTNHHQHQKHHS     71 - 140
AKKSLKRDMDRASYVKCCLFCMSLKPFRKWEVGKDLPAMLRLLRSLVFPGGKKPGTITECGEDIRSQKSH    141 - 210
YKSGECGKASRHKHTPVYHPRVYTGKKLYECSKCGKAFRGKYSLVQHQRVHTGERPWECNECGKFFSQTS    211 - 280
HLNDHRRIHTGERPYECSECGKLFRQNSSLVDHQKIHTGARPYECSQCGKSFSQKATLVKHQRVHTGERP    281 - 350
YKCGECGNSFSQSAILNQHRRIHTGAKPYECGQCGKSFSQKATLIKHQRVHTGERPYKCGDCGKSFSQSS    351 - 420
ILIQHRRIHTGARPYECGQCGKSFSQKSGLIQHQVVHTGERPYECNKCGNSFSQCSSLIHHQKCHNT       421 - 487
//

Text Mined References (5)

PMID Year Title