Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.33
PubTator Score 0.31

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q3SY17
Symbols MCART2

Gene

Gene RIF (1)

PMID Text
23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.

AA Sequence

MIDSEAHEKRPPILTSSKQDISPHITNVGEMKHYLCGCCAAFNNVAITYPIQKVLFRQQLYGIKTRDAVL      1 - 70
QLRRDGFRNLYRGILPPLMQKTTTLALMFGLYEDLSCLLRKHVRAPEFATHGVAAVLAGTAEAIFTPLER     71 - 140
VQTLLQNHKHHDKFTNTYQAFKALKCHGIGEYYRGLVPILFRNGLSNVLFFGLRGPIKEHLPTATTHSAH    141 - 210
LVNDFIGGGLLGAMLGFLCFPINVVKTRLQSQIGGEFQSFPKVFQKIWLERDRKLINLFRGAHLNYHRSL    211 - 280
ISWGIINATYEFLLKFI                                                         281 - 297
//

Text Mined References (5)

PMID Year Title
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.