Property Summary

NCBI Gene PubMed Count 4
PubMed Score 4.92
PubTator Score 3.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
pituitary cancer 1972 9.3e-05
chronic rhinosinusitis 512 1.4e-02
ependymoma 4679 2.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Primary ciliary dyskinesia 76 5.04 2.5

Expression

  Differential Expression (3)

Disease log2 FC p
chronic rhinosinusitis -1.094 1.4e-02
ependymoma 2.000 2.3e-02
pituitary cancer 1.200 9.3e-05

AA Sequence

MVPSREALLGPGTTAIRCPKKLQNQNYKGHGLSKGKEREQRASIRFKTTLMNTLMDVLRHRPGWVEVKDE      1 - 70
GEWDFYWCDVSWLRENFDHTYMDEHVRISHFRNHYELTRKNYMVKNLKRFRKQLEREAGKLEAAKCDFFP     71 - 140
KTFEMPCEYHLFVEEFRKNPGITWIMKPVARSQGKGIFLFRRLKDIVDWRKDTRSSDDQKDDIPVENYVA    141 - 210
QRYIENPYLIGGRKFDLRVYVLVMSVFAECLLWSGHRRQDVHLTNVAVQKTSPDYHPKKGCKWTLQRFRQ    211 - 280
YLASKHGPEAVETLFRDIDNIFVKSLQSVQKVIISDKHCFELYGYDILIDQDLKPWLLEVNASPSLTASS    281 - 350
QEDYELKTCLLEDTLHVVDMEARLTGREKRVGGFDLMWNDGPVSREEGAPDLSGMGNFVTNTHLGCVNDR    351 - 420
KKQLRQLFCSLQVQKKASS                                                       421 - 439
//

Text Mined References (6)

PMID Year Title