Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
cystic fibrosis 1696 8.2e-03
gastric cancer 459 1.1e-02
sonic hedgehog group medulloblastoma 467 2.7e-02

Expression

Gene RIF (1)

AA Sequence

MELLTFKDVAIEFSPEEWKCLDISQQNLYRDVMLENYRNLVSLGVTISNPDLVTSLEQRKEPYNLKIHET      1 - 70
AARPPAVCSHFTQNLWTVQGIEDSFHKLIPKGHEKRGHENLRKTCKSINECKVQKGGYNRINQCLLTTQK     71 - 140
KTIQSNICVKVFHKFSNSNKDKIRYTGDKTFKCKECGKSFHVLSRLTQHKRIHTGENPYTCEECGKAFNW    141 - 210
SSILTKHKRIHAREKFYKCEECGKGFTRSSHLTKHKRIHTGEKPYICEKCGKAFNQSSTLNLHKRIHSAQ    211 - 280
KYYKCEECGKAFKWSSSLNEHKRIHAGEKPFSCEECGNVFTTSSDFAKHKRIHTGEKPYKCEECGKSFNR    281 - 350
STTLTTHKRIHTGEKPYTCEECGKAFNWSSTLNVHKRIHSGKNPYKCEDCGKAFKVFANLHNRKKIHTGE    351 - 420
KPYICKQCGKAFKQSSHLNKHKKIHTVDKPYKCKECGKAFKQYSNLPQHKRTHTGGKF                421 - 478
//

Text Mined References (4)

PMID Year Title