Property Summary

NCBI Gene PubMed Count 26
PubMed Score 32.93
PubTator Score 17.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
chronic rhinosinusitis -1.063 5.0e-02
ependymoma 1.300 6.6e-09
glioblastoma multiforme 1.100 4.8e-17
invasive ductal carcinoma -1.573 1.8e-03
osteosarcoma 1.387 1.1e-02
ovarian cancer 1.300 1.4e-04
primitive neuroectodermal tumor 1.100 1.0e-02
progressive supranuclear palsy -1.200 1.7e-02
tuberculosis -1.400 2.7e-06

 GO Function (1)

 OMIM Phenotype (1)

Protein-protein Interaction (11)

Gene RIF (17)

AA Sequence

MFSLMASCCGWFKRWREPVRKVTLLMVGLDNAGKTATAKGIQGEYPEDVAPTVGFSKINLRQGKFEVTIF      1 - 70
DLGGGIRIRGIWKNYYAESYGVIFVVDSSDEERMEETKEAMSEMLRHPRISGKPILVLANKQDKEGALGE     71 - 140
ADVIECLSLEKLVNEHKCLCQIEPCSAISGYGKKIDKSIKKGLYWLLHVIARDFDALNERIQKETTEQRA    141 - 210
LEEQEKQERAERVRKLREERKQNEQEQAELDGTSGLAELDPEPTNPFQPIASVIIENEGKLEREKKNQKM    211 - 280
EKDSDGCHLKHKMEHEQIETQGQVNHNGQKNNEFGLVENYKEALTQQLKNEDETDRPSLESANGKKKTKK    281 - 350
LRMKRNHRVEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYRKPLPPLAVPQRPN    351 - 420
SDAHDVIS                                                                  421 - 428
//

Text Mined References (27)

PMID Year Title