Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 3.5e-10

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.100 3.5e-10

AA Sequence

MQAETILEGLEAGLPQAVSSGLSLVPAPGLVLTCLSAPSGPGGMALEPPPTTLRKAFLAQSTLLESTLEG      1 - 70
APEWAAPHPEEQRRSPPACSQHTPPLPSTPTGPPPCSPGGNHPLCALSGRGGGRCSIPSLSSSSTFSLFS     71 - 140
SGCWNPRVKLRVRKSQSQGRAGQLI                                                 141 - 165
//

Text Mined References (3)

PMID Year Title