Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.29
PubTator Score 0.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -2.100 0.002
posterior fossa group A ependymoma -3.100 0.000
oligodendroglioma -2.000 0.000
glioblastoma -2.600 0.000
group 3 medulloblastoma -3.100 0.000
atypical teratoid/rhabdoid tumor -1.400 0.009
medulloblastoma, large-cell -2.500 0.000
primitive neuroectodermal tumor -1.400 0.014
colon cancer -1.900 0.000
adult high grade glioma -2.800 0.000
pilocytic astrocytoma -3.100 0.000

AA Sequence

MTSCGQQSLNVLAVLFSLLFSAVLSAHFRVCEPYTDHKGRYHFGFHCPRLSDNKTFILCCHHNNTVFKYC      1 - 70
CNETEFQAVMQANLTASSEGYMHNNYTALLGVWIYGFFVLMLLVLDLLYYSAMNYDICKVYLARWGIQGR     71 - 140
WMKQDPRRWGNPARAPRPGQRAPQPQPPPGPLPQAPQAVHTLRGDAHSPPLMTFQSSSA               141 - 199
//

Text Mined References (6)

PMID Year Title
22120523 2012 Unexpected diversity in Shisa-like proteins suggests the importance of their roles as transmembrane adaptors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11258795 2001 Identification of novel transcribed sequences on human chromosome 22 by expressed sequence tag mapping.
10591208 1999 The DNA sequence of human chromosome 22.