Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.69
PubTator Score 4.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 7.3e-05
group 4 medulloblastoma 1855 2.1e-04
Disease Target Count Z-score Confidence
Placental insufficiency 18 3.28 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
group 4 medulloblastoma 1.200 2.1e-04
osteosarcoma -1.562 7.3e-05

Gene RIF (3)

AA Sequence

MAAVDSFYLLYREIARSCNCYMEALALVGAWYTARKSITVICDFYSLIRLHFIPRLGSRADLIKQYGRWA      1 - 70
VVSGATDGIGKAYAEELASRGLNIILISRNEEKLQVVAKDIADTYKVETDIIVADFSSGREIYLPIREAL     71 - 140
KDKDVGILVNNVGVFYPYPQYFTQLSEDKLWDIINVNIAAASLMVHVVLPGMVERKKGAIVTISSGSCCK    141 - 210
PTPQLAAFSASKAYLDHFSRALQYEYASKGIFVQSLIPFYVATSMTAPSNFLHRCSWLVPSPKVYAHHAV    211 - 280
STLGISKRTTGYWSHSIQFLFAQYMPEWLWVWGANILNRSLRKEALSCTA                        281 - 330
//

Text Mined References (11)

PMID Year Title