Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.69
PubTator Score 4.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.562 0.000
group 4 medulloblastoma 1.200 0.000

Gene RIF (3)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
19026618 characterized the subcellular localization as well as the tissue distribution and performed a screen for putative substrates of HSDL1 enzymes
12153137 novel human hydroxysteroid dehydrogenase like 1 gene (HSDL1) located on human chromosome 16q24.2 is highly expressed in reproductive tissues [HSDL1]

AA Sequence

MAAVDSFYLLYREIARSCNCYMEALALVGAWYTARKSITVICDFYSLIRLHFIPRLGSRADLIKQYGRWA      1 - 70
VVSGATDGIGKAYAEELASRGLNIILISRNEEKLQVVAKDIADTYKVETDIIVADFSSGREIYLPIREAL     71 - 140
KDKDVGILVNNVGVFYPYPQYFTQLSEDKLWDIINVNIAAASLMVHVVLPGMVERKKGAIVTISSGSCCK    141 - 210
PTPQLAAFSASKAYLDHFSRALQYEYASKGIFVQSLIPFYVATSMTAPSNFLHRCSWLVPSPKVYAHHAV    211 - 280
STLGISKRTTGYWSHSIQFLFAQYMPEWLWVWGANILNRSLRKEALSCTA                        281 - 330
//

Text Mined References (11)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
19026618 2009 Human and zebrafish hydroxysteroid dehydrogenase like 1 (HSDL1) proteins are inactive enzymes but conserved among species.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12153137 2001 A novel human hydroxysteroid dehydrogenase like 1 gene (HSDL1) is highly expressed in reproductive tissues.
More...