Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.8e-03
non primary Sjogren syndrome sicca 891 2.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.6

Expression

  Differential Expression (2)

Disease log2 FC p
non primary Sjogren syndrome sicca -1.100 2.3e-02
osteosarcoma -1.154 1.8e-03

AA Sequence

MEAERLRLLEEEAKLKKVARMGFNASSMLRKSQLGFLNVTSYSRLANELRVSCMERKKVQIRSLDPSSLA      1 - 70
SDRFNFILASTNSDQLFVVNQVEVEGSKYGIISLRTLKIPSFHVYVLRNLYVPNRKVKSLCWASLNQLDS     71 - 140
HVLLCFEGITDAPSCAVLLPASRFLSVHTRVNQPGMLCSFQIPEAWSCAWSLNTRAYHCFSAGLSQQVLL    141 - 210
TSVATGHQQSFDTSSDVLAQQFASTAPLLFNGCRSGEIFAIDLRCRNRGKGWRATRLFHDSAVTSVQILQ    211 - 280
EEQCLMASDMTGKIKLWDLRATKCVRQYEGHVNESAYLPLHVHEEEGIVVAVGQDCYTRIWSLHDAHLLR    281 - 350
TIPSPYSASEDDIPSVAFASRLGGIRGAAPGLLMAVRQDLYCFPFS                            351 - 396
//

Text Mined References (5)

PMID Year Title