Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.85
PubTator Score 2.12

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (2)

AA Sequence

MFLSLPTLTVLIPLVSLAGLFYSASVEENFPQGCTSTASLCFYSLLLPITIPVYVFFHLWTWMGIKLFRH      1 - 70
N//

Text Mined References (7)

PMID Year Title