Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.82
PubTator Score 2.12

Knowledge Summary

Patent

No data available

Synonym

Accession Q3MUY2
Symbols PIG-Y
HPMRS6

Gene

Gene RIF (2)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
18187620 Knockdown of phosphatidylinositol glycan anchor biosynthesis, class Y (PIGY) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MFLSLPTLTVLIPLVSLAGLFYSASVEENFPQGCTSTASLCFYSLLLPITIPVYVFFHLWTWMGIKLFRH      1 - 70
N//

Text Mined References (7)

PMID Year Title
26293662 2015 Mutations in PIGY: expanding the phenotype of inherited glycosylphosphatidylinositol deficiencies.
22925353 2013 A genome-wide association study of seasonal pattern mania identifies NF1A as a possible susceptibility gene for bipolar disorder.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19302917 2009 Silencing of genes required for glycosylphosphatidylinositol anchor biosynthesis in Burkitt lymphoma.
16162815 2005 The initial enzyme for glycosylphosphatidylinositol biosynthesis requires PIG-Y, a seventh component.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.