Property Summary

NCBI Gene PubMed Count 8
PubMed Score 2.16
PubTator Score 1.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 8.7e-250
Disease Target Count Z-score Confidence
Ileocolitis 5 4.613 2.3
Panic disorder 61 3.375 1.7

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.400 8.7e-250

Gene RIF (3)

AA Sequence

MLLRQMHARVSHSLPDPCQAEDSRPSATCALKAPQTSWDGLLREGLSPCHLLTVRVIRMKNVRQADMLSQ      1 - 70
TDCFVSLWLPTASQKKLRTRTISNCPNPEWNESFNFQIQSRVKNVLELSVCDEDTVTPDDHLLTVLYDLT     71 - 140
KLCFRKKTHVKFPLNPQGMEELEVEFLLEESPSPPETLVTNGVLVVIIFLGSCSSRGHGWLLLSGEQDQG    141 - 210
RKQWAQLVKDLLVMVNESFENTQRVRPCLEPCCPTSACFQTAACFHYPKYFQSQVHVEVPKSHWSCGLCC    211 - 280
RSRKKGPISQPLDCLSDGQVMTLPVGGGESLGSPETLDVRLGFSLCPAELEFLQKRKVVVAKALKQVLQL    281 - 350
EEDLQEDEVPLIAIMATGGGTRSMTSMYGHLLGLQKLNLLDCASYITGLSGATWTMATLYRDPDWSSKNL    351 - 420
EPAIFEARRHVVKDKLPSLFPDQLRKFQEELRQRSQEGYRVTFTDFWGLLIETCLGDERNECKLSDQRAA    421 - 490
LSCGQNPLPIYLTINVKDDVSNQDFREWFEFSPYEVGLQKYGAFIPSELFGSEFFMGRLVKRIPESRICY    491 - 560
MLGLWSSIFSLNLLDAWNLSHTSEEFFHRWTREKVQDIEDEPILPEIPKCDANILETTVVIPGSWLSNSF    561 - 630
REILTHRSFVSEFHNFLSGLQLHTNYLQNGQFSRWKDTVLDGFPNQLTESANHLCLLDTAFFVNSSYPPL    631 - 700
LRPERKADLIIHLNYCAGSQTKPLKQTCEYCTVQNIPFPKYELPDENENLKECYLMENPQEPDAPIVTFF    701 - 770
PLINDTFRKYKAPGVERSPEELEQGQVDIYGPKTPYATKELTYTEATFDKLVKLSEYNILNNKDTLLQAL    771 - 840
RLAVEKKKRLKGQCPS                                                          841 - 856
//

Text Mined References (8)

PMID Year Title