Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.44
PubTator Score 1.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Ileocolitis 6 4.813 2.4
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.400 0.000

Synonym

Accession Q3MJ16 B7WPN2 Q6ZSC0 cPLA2-epsilon
Symbols

Gene

PANTHER Protein Class (3)

Gene RIF (3)

PMID Text
24413173 Cytoplasmic PLA2 epsilonepsilon is a new important regulator of trafficking processes within the clathrin-independent endocytic and recycling route.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLLRQMHARVSHSLPDPCQAEDSRPSATCALKAPQTSWDGLLREGLSPCHLLTVRVIRMKNVRQADMLSQ      1 - 70
TDCFVSLWLPTASQKKLRTRTISNCPNPEWNESFNFQIQSRVKNVLELSVCDEDTVTPDDHLLTVLYDLT     71 - 140
KLCFRKKTHVKFPLNPQGMEELEVEFLLEESPSPPETLVTNGVLVVIIFLGSCSSRGHGWLLLSGEQDQG    141 - 210
RKQWAQLVKDLLVMVNESFENTQRVRPCLEPCCPTSACFQTAACFHYPKYFQSQVHVEVPKSHWSCGLCC    211 - 280
RSRKKGPISQPLDCLSDGQVMTLPVGGGESLGSPETLDVRLGFSLCPAELEFLQKRKVVVAKALKQVLQL    281 - 350
EEDLQEDEVPLIAIMATGGGTRSMTSMYGHLLGLQKLNLLDCASYITGLSGATWTMATLYRDPDWSSKNL    351 - 420
EPAIFEARRHVVKDKLPSLFPDQLRKFQEELRQRSQEGYRVTFTDFWGLLIETCLGDERNECKLSDQRAA    421 - 490
LSCGQNPLPIYLTINVKDDVSNQDFREWFEFSPYEVGLQKYGAFIPSELFGSEFFMGRLVKRIPESRICY    491 - 560
MLGLWSSIFSLNLLDAWNLSHTSEEFFHRWTREKVQDIEDEPILPEIPKCDANILETTVVIPGSWLSNSF    561 - 630
REILTHRSFVSEFHNFLSGLQLHTNYLQNGQFSRWKDTVLDGFPNQLTESANHLCLLDTAFFVNSSYPPL    631 - 700
LRPERKADLIIHLNYCAGSQTKPLKQTCEYCTVQNIPFPKYELPDENENLKECYLMENPQEPDAPIVTFF    701 - 770
PLINDTFRKYKAPGVERSPEELEQGQVDIYGPKTPYATKELTYTEATFDKLVKLSEYNILNNKDTLLQAL    771 - 840
RLAVEKKKRLKGQCPS                                                          841 - 856
//

Text Mined References (8)

PMID Year Title
24413173 2014 Cytosolic phospholipase A?? drives recycling through the clathrin-independent endocytic route.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15866882 2005 Identification of novel cytosolic phospholipase A(2)s, murine cPLA(2){delta}, {epsilon}, and {zeta}, which form a gene cluster with cPLA(2){beta}.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.