Property Summary

NCBI Gene PubMed Count 18
PubMed Score 14.79
PubTator Score 13.08

Knowledge Summary


No data available


  Differential Expression (2)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.024 0.005
ovarian cancer -1.300 0.000


Accession Q3MIT2 Q5JPJ5 Q96MI8
Symbols DOBI




  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG Inparanoid
Fruitfly OMA EggNOG Inparanoid

Gene RIF (7)

21072187 Observational study of gene-disease association. (HuGE Navigator)
20468071 Observational study of gene-disease association. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19712588 These data suggest that the cleaved DOBI may acquire a new function, possibly by cooperating with tBid in the mitochondrial event of cell death caused by TRAIL.
19240061 Observational study of gene-disease association. (HuGE Navigator)
19068216 Observational study of gene-disease association. (HuGE Navigator)
17900615 crystal structure of Pus10 (previously denoted as FLJ32312) at 2.0 A resolution and modeling studies describe protein domains and active sites

AA Sequence

HGDFGRTKPNIGSLMNVTADILELDVESVDVDWPPALDD                                   491 - 529

Text Mined References (23)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
21298027 2011 A meta-analysis of genome-wide association scans identifies IL18RAP, PTPN2, TAGAP, and PUS10 as shared risk loci for Crohn's disease and celiac disease.
21297633 2011 Meta-analysis identifies 29 additional ulcerative colitis risk loci, increasing the number of confirmed associations to 47.
21102463 2010 Genome-wide meta-analysis increases to 71 the number of confirmed Crohn's disease susceptibility loci.
21072187 2010 Evidence for significant overlap between common risk variants for Crohn's disease and ankylosing spondylitis.
20468071 2010 Evidence for genes on chromosome 2 contributing to alcohol dependence with conduct disorder and suicide attempts.
20228799 2010 Genome-wide association identifies multiple ulcerative colitis susceptibility loci.
20190752 2010 Multiple common variants for celiac disease influencing immune gene expression.