Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.24
PubTator Score 0.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 2.7e-10
malignant mesothelioma 3232 1.3e-08
psoriasis 6694 2.4e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Tetralogy of Fallot 67 3.516 1.8
Cleft Lip 141 3.072 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma -2.600 1.3e-08
osteosarcoma -3.528 2.7e-10
psoriasis -4.400 2.4e-06

AA Sequence

MALTQGPLKFMDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLGICLPDLSVTSMLEQKRDPWTLQ      1 - 70
SEEKIANDPDGRECIKGVNTERSSKLGSNAGNKPCKNQLGFTFQLHLSDLQLFQAERKISGCKHFEKPVS     71 - 140
DNSSVSPLEKISSSVKSHLLNKYRNNFDHAPLLPQEQKAHIREKAYKCNEHGQVFRASASLTNQVIHNAD    141 - 210
NPYKCSECGKVFSCSSKLVIHRRMHTGEKPYKCHECGKLFSSNSNLSQHQRIHTGEKPYKCHECDKVFRS    211 - 280
SSKLAQHQRIHTGEKPYKCHECDKVFNQIAHLVRHQKIHTGEKPYSCNKCGKVFSRHSYLAEHQTVHTGE    281 - 350
KPYKCEECGKAFSVRSSLITHQLIHTGRKPYKCKECDKVFGRKCFLTSHQRIHTRERPYGCSQCGKIFSQ    351 - 420
KSDLIRHRKTHTDEKPYKCNKCGTAFREFSDLTAHFLIHSGEKPYECKECGKVFRYKSSLTSHHRIHTGE    421 - 490
KPYKCNRCGKVFSRSSNLVCHQKIHTGEKPYKCNQCGKVFNQASYLTRHQIIHTGERPYRCSKCGKAFRG    491 - 560
CSGLTAHLAIHTEKKSHECKECGKIFTQKSSLTNHHRIHIGEKPYKCTLCSKVFSHNSDLAQHQRVHS      561 - 628
//

Text Mined References (5)

PMID Year Title