Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.60
PubTator Score 2.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
nephrosclerosis -1.074 0.010
intraductal papillary-mucinous neoplasm ... 1.500 0.024
lung cancer -2.100 0.001
colon cancer -1.800 0.000
breast carcinoma 1.200 0.037
interstitial cystitis -4.100 0.000
non primary Sjogren syndrome sicca 1.100 0.044
spina bifida -2.184 0.032
ductal carcinoma in situ 1.600 0.009
invasive ductal carcinoma 1.700 0.022
ovarian cancer 1.100 0.009

Gene RIF (1)

PMID Text
20685720 Downregulation of TMEM30B is associated with recurrence in meningiomas.

AA Sequence

MTWSATARGAHQPDNTAFTQQRLPAWQPLLSASIALPLFFCAGLAFIGLGLGLYYSSNGIKELEYDYTGD      1 - 70
PGTGNCSVCAAAGQGRALPPPCSCAWYFSLPELFQGPVYLYYELTNFYQNNRRYGVSRDDAQLSGLPSAL     71 - 140
RHPVNECAPYQRSAAGLPIAPCGAIANSLFNDSFSLWHQRQPGGPYVEVPLDRSGIAWWTDYHVKFRNPP    141 - 210
LVNGSLALAFQGTAPPPNWRRPVYELSPDPNNTGFINQDFVVWMRTAALPTFRKLYARIRQGNYSAGLPR    211 - 280
GAYRVNITYNYPVRAFGGHKLLIFSSISWMGGKNPFLGIAYLVVGSLCILTGFVMLVVYIRYQDQDDDDE    281 - 350
E//

Text Mined References (10)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
21914794 2011 ATP9B, a P4-ATPase (a putative aminophospholipid translocase), localizes to the trans-Golgi network in a CDC50 protein-independent manner.
20961850 2010 CDC50 proteins are critical components of the human class-1 P4-ATPase transport machinery.
20947505 2010 Heteromeric interactions required for abundance and subcellular localization of human CDC50 proteins and class 1 P4-ATPases.
20685720 2010 Differential expression profiling analyses identifies downregulation of 1p, 6q, and 14q genes and overexpression of 6p histone cluster 1 genes as markers of recurrence in meningiomas.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15375526 2004 Identification and characterization of CDC50A, CDC50B and CDC50C genes in silico.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.