Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.67
PubTator Score 2.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
breast carcinoma 1.200 3.7e-02
colon cancer -1.800 1.4e-04
ductal carcinoma in situ 1.600 9.1e-03
interstitial cystitis -3.100 4.7e-03
intraductal papillary-mucinous neoplasm ... 1.500 2.4e-02
invasive ductal carcinoma 1.700 2.2e-02
lung cancer -2.100 5.3e-04
nephrosclerosis -1.074 9.6e-03
non primary Sjogren syndrome sicca 1.100 4.4e-02
ovarian cancer 1.100 8.8e-03
spina bifida -2.184 3.2e-02

Gene RIF (1)

AA Sequence

MTWSATARGAHQPDNTAFTQQRLPAWQPLLSASIALPLFFCAGLAFIGLGLGLYYSSNGIKELEYDYTGD      1 - 70
PGTGNCSVCAAAGQGRALPPPCSCAWYFSLPELFQGPVYLYYELTNFYQNNRRYGVSRDDAQLSGLPSAL     71 - 140
RHPVNECAPYQRSAAGLPIAPCGAIANSLFNDSFSLWHQRQPGGPYVEVPLDRSGIAWWTDYHVKFRNPP    141 - 210
LVNGSLALAFQGTAPPPNWRRPVYELSPDPNNTGFINQDFVVWMRTAALPTFRKLYARIRQGNYSAGLPR    211 - 280
GAYRVNITYNYPVRAFGGHKLLIFSSISWMGGKNPFLGIAYLVVGSLCILTGFVMLVVYIRYQDQDDDDE    281 - 350
E//

Text Mined References (11)

PMID Year Title