Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.09
PubTator Score 0.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
acute quadriplegic myopathy 1.039 4.3e-05
adult high grade glioma 1.200 3.8e-03
aldosterone-producing adenoma -1.048 2.7e-02
Alzheimer's disease 1.500 1.8e-02
Astrocytoma, Pilocytic 1.400 1.1e-04
atypical teratoid / rhabdoid tumor 1.600 1.4e-03
autosomal dominant Emery-Dreifuss muscul... 1.241 9.8e-04
ependymoma 1.100 2.7e-04
gastric cancer 1.100 3.4e-02
glioblastoma 1.100 5.8e-04
group 4 medulloblastoma -1.300 4.4e-03
hepatocellular carcinoma 1.400 1.2e-05
inflammatory breast cancer 1.100 1.0e-02
juvenile dermatomyositis 1.292 6.0e-13
osteosarcoma 2.011 1.5e-04
ovarian cancer -1.800 2.6e-04
pancreatic cancer 1.300 1.3e-03
pancreatic carcinoma 1.300 1.3e-03
Pick disease 2.300 9.4e-05
pituitary cancer -1.600 1.6e-03
primary pancreatic ductal adenocarcinoma 1.217 2.1e-02
primitive neuroectodermal tumor 1.200 1.3e-02
Rheumatoid arthritis 2.300 4.5e-03
subependymal giant cell astrocytoma 2.160 3.7e-03
tuberculosis -1.100 1.7e-04

AA Sequence

MSVHYTLNLRVFWPLVTGLCTALVCLYHVLRGSGGARAEPADGVDGGFPLLKVAVLLLLSYVLLRCRHAV      1 - 70
RQRFLPGSPRLEGHAAFSSRHFREPGLSILLESYYEHEVRLSPHVLGHSKAHVSRIVGELVRAGRARGSP     71 - 140
GLIPGGALALAFRGDFIQVGSAYEQHKIRRPDSFDVLVPLRLPPLVALEPRSLGEEPALAPAFRGCFLCA    141 - 210
LKAPPSPSGASGGHWLRDCKPFADAFCVDVRGRRHLSATLVLRWFQSHLQRSLATVRYSLEGRCRVTLTP    211 - 280
GGLEQPPTLHILPCRTDYGCCRLSMAVRLIPAVHLGDGVFLVAPPPPPLPSAPLLELPEGLRAEALWGVN    281 - 350
TARQEQKLLSWLQERAAPGACYLKCLQLLKALRDLGARGLDSAAATQWGRILSSYVLKTVLLAVLLRKGA    351 - 420
PGQGWDEEHLGRCLEELVQFLRDCLLRRHTLFHCVLGPGGAAAEVGPLPKALREAAPVDLLAAFDGHARE    421 - 490
LAAARLLSTWQRLPQLLRAYGGPRYLARCPPPRSQRTQGFLEGEP                             491 - 535
//

Text Mined References (5)

PMID Year Title