Property Summary

NCBI Gene PubMed Count 5
PubMed Score 5.89
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
group 3 medulloblastoma 1.600 4.7e-03
lung adenocarcinoma 1.110 1.6e-09
lung cancer 1.400 1.1e-02
Multiple myeloma 1.647 1.9e-04
non primary Sjogren syndrome sicca -1.200 6.7e-03
osteosarcoma 1.055 1.7e-02
ovarian cancer 1.300 1.8e-03
progressive supranuclear palsy 1.100 1.0e-02

Gene RIF (2)

AA Sequence

MAAPPGEYFSVGSQVSCRTCQEQRLQGEVVAFDYQSKMLALKCPSSSGKPNHADILLINLQYVSEVEIIN      1 - 70
DRTETPPPLASLNVSKLASKARTEKEEKLSQAYAISAGVSLEGQQLFQTIHKTIKDCKWQEKNIVVMEEV     71 - 140
VITPPYQVENCKGKEGSALSHVRKIVEKHFRDVESQKILQRSQAQQPQKEAALSS                   141 - 195
//

Text Mined References (12)

PMID Year Title