Property Summary

NCBI Gene PubMed Count 5
PubMed Score 4.69
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.647 0.000
osteosarcoma 3.348 0.000
group 3 medulloblastoma 1.600 0.005
lung cancer 1.400 0.011
non primary Sjogren syndrome sicca -1.200 0.007
lung adenocarcinoma 1.110 0.000
progressive supranuclear palsy 1.100 0.010
ovarian cancer 1.300 0.002

Gene RIF (2)

PMID Text
25010285 Interaction of HIV-1 Gag with LSM12 homolog (LSM12) is identified in a series of six affinity purification/mass spectrometry screens
22190034 Interaction of HIV-1 Gag with LSM12 homolog (LSM12) is identified in a series of six affinity purification/mass spectrometry screens

AA Sequence

MAAPPGEYFSVGSQVSCRTCQEQRLQGEVVAFDYQSKMLALKCPSSSGKPNHADILLINLQYVSEVEIIN      1 - 70
DRTETPPPLASLNVSKLASKARTEKEEKLSQAYAISAGVSLEGQQLFQTIHKTIKDCKWQEKNIVVMEEV     71 - 140
VITPPYQVENCKGKEGSALSHVRKIVEKHFRDVESQKILQRSQAQQPQKEAALSS                   141 - 195
//

Text Mined References (12)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15252450 2004 Lineage-specific gene duplication and loss in human and great ape evolution.
15225602 2004 Novel Sm-like proteins with long C-terminal tails and associated methyltransferases.
More...